Diaphorina citri psyllid: psy15420


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
PCILSFVPVGLREQLYRERIVEVESKLNEVELGQAKEYLLPLQKLQDNMRIRTEVAAILRQYKLNNVQNQYNAEEQATRQNLENEKSLLYDHMKEELEEKIRRLEEDRNSVDINADLWFFEHNKRGSNQNPLSSKRGPKGFNRMKSRRKAVTVSGPYIVYMLRDEEIIEDWTIIKKAMSQRKCDLTY
ccccccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHccccHHHHHHHHHHHHHHHccccccccc
PCILSFVPVGLREQLYRERIVEVESKLNEVELGQAKEYLLPLQKLQDNMRIRTEVAAILRQYKLNNVQNQYNAEEQATRQNLENEKSLLYDHMKEELEEKIRRLEEDRNSVDINADLWFFE****************************AVTVSGPYIVYMLRDEEIIEDWTIIKKA**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PCILSFVPVGLREQLYRERIVEVESKLNEVELGQAKEYLLPLQKLQDNMRIRTEVAAILRQYKLNNVQNQYNAEEQATxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADLWFFEHNKRGSNQNPLSSKRGPKGFNRMKSRRKAVTVSGPYIVYMLRDEEIIEDWTIIKKAMSQRKCDLTY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Breast cancer metastasis-suppressor 1-like protein Involved in the histone deacetylase (HDAC1)-dependent transcriptional repression activity.confidentA4II71
Breast cancer metastasis-suppressor 1-like protein Involved in the histone deacetylase (HDAC1)-dependent transcriptional repression activity. When overexpressed in lung cancer cell line that lacks p53/TP53 expression, inhibits cell growth.confidentQ5PSV4
Breast cancer metastasis-suppressor 1 homolog Transcriptional repressor. Down-regulates transcription activation by NF-kappa-B by promoting the deacetylation of RELA at 'Lys-310'. Promotes HDAC1 binding to promoter regions. Down-regulates expression of anti-apoptotic genes that are controlled by NF-kappa-B. Promotes apoptosis in cells that have inadequate adherence to a substrate, a process called anoikis, and may thereby inhibit metastasis.confidentQ5M7T3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051059 [MF]NF-kappaB bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0032088 [BP]negative regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0070822 [CC]Sin3-type complexprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044454, GO:0044451, GO:0005694, GO:0000118, GO:0000790, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0090312 [BP]positive regulation of protein deacetylationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0090311, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0050789, GO:0032270, GO:0008150, GO:0031399, GO:0048518, GO:0065007, GO:0019222, GO:0010604, GO:0031325, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XUS, chain A
Confidence level:probable
Coverage over the Query: 4-16
View the alignment between query and template
View the model in PyMOL