Diaphorina citri psyllid: psy15424

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MRGRGGGGGGEREGGKVRETEEEEEEEVEKWERLGERGGDTDLCGIKWRKLVHGDSAGTGYSPGSEPLEDPVLASYAKCLAGDILCVWRRVGTPQNGGSGGGGGGLFDSIGLPQVTSVPPLSLQAAKELWIFWYGEEPDLSSIVTPELFSSGE
cccccccccccccccccccccHHHHHHHHHHHHHHcccccccccccEEEEEEccccccccccccccccccHHHHHHHHHHHcccEEEEEEcccccccccccccccccccccccccccccccccccccEEEEEECccccccccccccccccccc
**********************************GERGGDTDLCGIKWRKLVHGDSA**G***GSEPLEDPVLASYAKCLAGDILCVWRRVG************************SVPPLSLQAAKELWIFWYGEEPDLSSIVTPEL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRGRGGGGGGEREGGKVRETEEEEEEEVEKWERLGERGGDTDLCGIKWRKLVHGDSAGTGYSPGSEPLEDPVLASYAKCLAGDILCVWRRVGTPQNGGSGGGGGGLFDSIGLPQVTSVPPLSLQAAKELWIFWYGEEPDLSSIVTPELFSSGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

No confident structure templates for the query are predicted