Diaphorina citri psyllid: psy15438

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------36
MRDVDLTDNLPKEFLGTKHAEYIKKYSDNKEDYEYCMSEYLRMSGMYWGITTLSLLDQLDDMPQDTIFDFITQCIHPCGGVSASISHDPHILYTLSAVQIACLINREHELPVDKIVAYVSKLQQPDGSFFGDMYGEVDTRFSFCAVACLSLLGKLDAINLSKAVEFILSCCNFDGGFGSRPGSESHAGLTYCCVGFLSITGHLHEIDADKLAWWLAERQLPSGGLNGRPEKLPDVCYSWWVLASLHMLGRGTWINSAALRKFILASQVRNTFYFEMGVFSDKIPVCGVHYVDYCTQVRNRIEQGCSVRTCISDRPLDIPDPFHTLFGVAALTMLDPPTPDVLPVDPTYCMPVRTFHSE
cccccccccccccccHHHHHHHHHHHHccccccccHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHccccHHcHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHccc
*********LPKEFLGTKHAEYIKKYSDNKEDYEYCMSEYLRMSGMYWGITTLSLLDQLDDMPQDTIFDFITQCIHPCGGVSASISHDPHILYTLSAVQIACLINREHELPVDKIVAYVSKLQQPDGSFFGDMYGEVDTRFSFCAVACLSLLGKLDAINLSKAVEFILSCCNFDGGFGSRPGSESHAGLTYCCVGFLSITGHLHEIDADKLAWWLAERQLPSGGLNGRPEKLPDVCYSWWVLASLHMLGRGTWINSAALRKFILASQVRNTFYFEMGVFSDKIPVCGVHYVDYCTQVRNRIEQGCSVRTCISDRPLDIPDPFHTLFGVAALTMLDPPTPDVLPVDPTYCMPVRT****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRDVDLTDNLPKEFLGTKHAEYIKKYSDNKEDYEYCMSEYLRMSGMYWGITTLSLLDQLDDMPQDTIFDFITQCIHPCGGVSASISHDPHILYTLSAVQIACLINREHELPVDKIVAYVSKLQQPDGSFFGDMYGEVDTRFSFCAVACLSLLGKLDAINLSKAVEFILSCCNFDGGFGSRPGSESHAGLTYCCVGFLSITGHLHEIDADKLAWWLAERQLPSGGLNGRPEKLPDVCYSWWVLASLHMLGRGTWINSAALRKFILASQVRNTFYFEMGVFSDKIPVCGVHYVDYCTQVRNRIEQGCSVRTCISDRPLDIPDPFHTLFGVAALTMLDPPTPDVLPVDPTYCMPVRTFHSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Geranylgeranyl transferase type-2 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.very confidentQ08603
Geranylgeranyl transferase type-2 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.very confidentP53612
Geranylgeranyl transferase type-2 subunit beta Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively.very confidentP53611

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004663 [MF]Rab geranylgeranyltransferase activityprobableGO:0004659, GO:0003824, GO:0016765, GO:0016740, GO:0003674, GO:0004661, GO:0008318
GO:0018344 [BP]protein geranylgeranylationprobableGO:0044267, GO:0018342, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0097354, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0007601 [BP]visual perceptionprobableGO:0032501, GO:0044707, GO:0050877, GO:0007600, GO:0050953, GO:0008150, GO:0044699, GO:0003008
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008219 [BP]cell deathprobableGO:0010259, GO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.60Protein geranylgeranyltransferase type II.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3DSS, chain B
Confidence level:very confident
Coverage over the Query: 1-279,312-356
View the alignment between query and template
View the model in PyMOL