Diaphorina citri psyllid: psy15440

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------8
MQISRRDASRAFATFTVTPGKDEYDDLSDLNPAEWESVREWEEQLDSKYTYIGKLLKPGESHINYEDEEKGSIEEKKDL
cccccHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEECcccccccccccccccccHHcccc
********SRAFATFTVTPGKDEYDDLSDLNPAEWESVREWEEQLDSKYTYIGKLLK**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQISRRDASRAFATFTVTPGKDEYDDLSDLNPAEWESVREWEEQLDSKYTYIGKLLKPGESHINYEDEEKGSIEEKKDL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Membrane-associated progesterone receptor component 2 Receptor for steroids.confidentQ80UU9
Membrane-associated progesterone receptor component 2 Receptor for steroids.confidentO15173
Membrane-associated progesterone receptor component 2 Receptor for steroids.confidentQ5XIU9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035100 [MF]ecdysone bindingprobableGO:0032934, GO:0043178, GO:0097159, GO:0008289, GO:0036094, GO:0003674, GO:0005488, GO:0005496, GO:0042562
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1J03, chain A
Confidence level:very confident
Coverage over the Query: 2-56
View the alignment between query and template
View the model in PyMOL