Diaphorina citri psyllid: psy15447

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------
MIVTEQLDFYTSVGLFLPLTLFIVLSLSLSKHKKHTINVDALINNWTPEPIVSKAEKFKDVSSKYVVDQKSGYIVNINGIPCINFATHNYLSFVENPDIEKCAIDCIDKNGVGSCGPRGFYGTNVVHLDLENDIASFMGLEETALYSFGFSTSASAIAAYVKRNDAVFVDENINFAIQTGLIASRCKVQYFKHNNMQHLEELLRQQDERDTLNSKVTKKFIIVEGVYMNSADICPLKDILSLRSKYQARIFVDESVSFGTLGSTGHGVTEYFGVSTEEVDMIIGSLEHALGSVGGFCVGSSYIIEHHRLSGSGYCFSASLPPFLAVAANKALHLLKANPSLLTKLREKCNTMHSLLSQHKVTQRFLVQGHRDTPLKYLYLQKSDDEVASKKLLQTICDMCIQAGFAITCPSHLDQEAKKQKPSIRITCNISHTEQDMNSLIETLCKSHDIAVQPLNV
cEEEEEcccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccccccccEEEECccccCEEEEccEEEEEEcccccccccccHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccccEEEEccHHHHHHHccccccccccEEEECccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccccccccEEEEEEEEEEccccccccccHHHHHHHHHccEEEEEEcccccccccccccccccccccccccccEEEcccccccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccEEccccccccEEEEEEcccccHHHHHHHHHHHHHHHHHcccEEEcccccccccccccccEEEECcccccHHHHHHHHHHHHHHHHHccccccc
*IVTEQLDFYTSVGLFLPLTLFIVLSLSLSKHKKHTINVDALINNWTPEPIVSKAEKFKDVSSKYVVDQKSGYIVNINGIPCINFATHNYLSFVENPDIEKCAIDCIDKNGVGSCGPRGFYGTNVVHLDLENDIASFMGLEETALYSFGFSTSASAIAAYVKRNDAVFVDENINFAIQTGLIASRCKVQYFKHNNMQHLEELL********LNSKVTKKFIIVEGVYMNSADICPLKDILSLRSKYQARIFVDESVSFGTLGSTGHGVTEYFGVSTEEVDMIIGSLEHALGSVGGFCVGSSYIIEHHRLSGSGYCFSASLPPFLAVAANKALHLLKANPSLLTKLREKCNTMHSLLSQHKVTQRFLVQGHRDTPLKYLYLQKSDDEVASKKLLQTICDMCIQAGFAITCPSHLDQEAKKQKPSIRITCNISHTEQDMNSLIETLCKSHDIAVQPLN*
xxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIVTEQLDFYTSVGLFLPLTLFIVLSLSLSKHKKHTINVDALINNWTPEPIVSKAEKFKDVSSKYVVDQKSGYIVNINGIPCINFATHNYLSFVENPDIEKCAIDCIDKNGVGSCGPRGFYGTNVVHLDLENDIASFMGLEETALYSFGFSTSASAIAAYVKRNDAVFVDENINFAIQTGLIASRCKVQYFKHNNMQHLEELLRQQDERDTLNSKVTKKFIIVEGVYMNSADICPLKDILSLRSKYQARIFVDESVSFGTLGSTGHGVTEYFGVSTEEVDMIIGSLEHALGSVGGFCVGSSYIIEHHRLSGSGYCFSASLPPFLAVAANKALHLLKANPSLLTKLREKCNTMHSLLSQHKVTQRFLVQGHRDTPLKYLYLQKSDDEVASKKLLQTICDMCIQAGFAITCPSHLDQEAKKQKPSIRITCNISHTEQDMNSLIETLCKSHDIAVQPLNV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine palmitoyltransferase 1 Serine palmitoyltransferase (SPT). The heterodimer formed with SPTLC2 or SPTLC3 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16-CoA as substrates, with a slight preference for C14-CoA. The SPTLC1-SPTLC2-SPTSSB complex shows a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme displays an ability to use a broader range of acyl-CoAs, without apparent preference.confidentO15269
Serine palmitoyltransferase 1 Component of the serine palmitoyltransferase (SPT) that catalyzes the first committed step in sphingolipid biosynthesis, which is the condensation of an acyl-CoA species and L-serine. The catalytic core is composed of a heterodimer of sptl-1 and sptl-2 or sptl-1 and sptl-3 (By similarity). Required for the specification of abicobasal polarity and development of the gut lumen.confidentP91079
Serine palmitoyltransferase 1 Serine palmitoyltransferase (SPT). The heterodimer formed with SPTLC2 or SPTLC3 constitutes the catalytic core. The composition of the serine palmitoyltransferase (SPT) complex determines the substrate preference. The SPTLC1-SPTLC2-SPTSSA complex shows a strong preference for C16-CoA substrate, while the SPTLC1-SPTLC3-SPTSSA isozyme uses both C14-CoA and C16-CoA as substrates. The SPTLC1-SPTLC2-SPTSSB complex displays a strong preference for C18-CoA substrate, while the SPTLC1-SPTLC3-SPTSSB isozyme has the ability to use a broader range of acyl-CoAs.confidentQ3MHG1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0035339 [CC]SPOTS complexprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0017059, GO:0031211, GO:0012505, GO:0002178, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006686 [BP]sphingomyelin biosynthetic processprobableGO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:0006629, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006576, GO:0006684, GO:0046467, GO:0006665, GO:0030148, GO:0006644, GO:0006643, GO:0009308, GO:0044238, GO:0046165, GO:0009987, GO:0044106, GO:0009058, GO:0042439, GO:0008152, GO:1901564, GO:0044255, GO:0090407, GO:0008610, GO:0043604, GO:0044271, GO:1901566, GO:0043603, GO:0008654, GO:0044237, GO:0006066, GO:0006796, GO:0006793, GO:0019637, GO:0008150, GO:1901617, GO:1901615
GO:0004758 [MF]serine C-palmitoyltransferase activityprobableGO:0003824, GO:0016740, GO:0016746, GO:0016747, GO:0003674, GO:0016409, GO:0016408, GO:0016454
GO:0030170 [MF]pyridoxal phosphate bindingprobableGO:0043168, GO:0003674, GO:0048037, GO:0005488, GO:0043167
GO:0043067 [BP]regulation of programmed cell deathprobableGO:0008150, GO:0010941, GO:0065007, GO:0050789, GO:0050794
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009536 [CC]plastidprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0040027 [BP]negative regulation of vulval developmentprobableGO:0051093, GO:0050793, GO:0051241, GO:0040028, GO:0048581, GO:0048580, GO:0050789, GO:0065007, GO:2000026, GO:0008150, GO:0051239, GO:0048519, GO:0061062, GO:0061064
GO:0046512 [BP]sphingosine biosynthetic processprobableGO:0046173, GO:0019751, GO:0034311, GO:0044249, GO:0034641, GO:0034312, GO:0044281, GO:0044283, GO:0006629, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0046520, GO:0046467, GO:0006665, GO:0030148, GO:0006643, GO:0046165, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0044255, GO:0008610, GO:0044238, GO:0044271, GO:1901566, GO:0044237, GO:0006066, GO:0006807, GO:0046519, GO:1901615, GO:1901617, GO:0006670
GO:0046513 [BP]ceramide biosynthetic processprobableGO:0030148, GO:1901576, GO:0006629, GO:0044238, GO:1901564, GO:0006643, GO:1901566, GO:0071704, GO:0009987, GO:0044710, GO:0044237, GO:0006665, GO:0044249, GO:0009058, GO:0006807, GO:0008150, GO:0008152, GO:0046467, GO:0044255, GO:0006672, GO:0008610
GO:0046511 [BP]sphinganine biosynthetic processprobableGO:0046173, GO:0019751, GO:0034311, GO:0044249, GO:0034641, GO:0034312, GO:0044281, GO:0044283, GO:0006629, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0046520, GO:0046467, GO:0006665, GO:0006667, GO:0030148, GO:0006643, GO:0046165, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0044255, GO:0008610, GO:0044238, GO:0044271, GO:1901566, GO:0044237, GO:0006066, GO:0006807, GO:0046519, GO:1901617, GO:1901615
GO:0045197 [BP]establishment or maintenance of epithelial cell apical/basal polarityprobableGO:0035088, GO:0061245, GO:0009987, GO:0007163, GO:0044763, GO:0008150, GO:0044699
GO:0016049 [BP]cell growthprobableGO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2W8T, chain A
Confidence level:very confident
Coverage over the Query: 36-454
View the alignment between query and template
View the model in PyMOL
Template: 4AO9, chain A
Confidence level:confident
Coverage over the Query: 29-411,425-452
View the alignment between query and template
View the model in PyMOL