Diaphorina citri psyllid: psy15458


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170------
MVHSCTNLMMQQVQKELNASLTYLAMGVHFSRDCVNRPGFAKFSSRVLVRSGGEHAIKFSSSYLTMRGNLTDYHHHQGVNKMTWNSAAHAVQDALNLETQVTESIRKIIIECEQGTNNVHDLESVNDYHLSDWLTGEFLDEQYKGQRKLAGMLSTMRKTEGTHGKLTEFLMDKEFL
ccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHccccccc
**HSCTNLMMQQVQKELNASLTYLAMGVHFSRDCVNRPGFAKFSSRVLVRSGGEHAIKFSSSYLTMRGNLTDYHHHQGVNKMTWNSAAHAVQDALNLETQVTESIRKIIIECEQGTNNVHDLESVNDYHLSDWLTGEFLDEQYKGQRKLAGMLSTMRKTEGTHGKLTEFLMDKEFL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHSCTNLMMQQVQKELNASLTYLAMGVHFSRDCVNRPGFAKFSSRVLVRSGGEHAIKFSSSYLTMRGNLTDYHHHQGVNKMTWNSAAHAVQDALNLETQVTESIRKIIIECEQGTNNVHDLESVNDYHLSDWLTGEFLDEQYKGQRKLAGMLSTMRKTEGTHGKLTEFLMDKEFL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentP09528
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentP29389
Ferritin heavy chain Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidase activity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation. Also plays a role in delivery of iron to cells. Mediates iron uptake in capsule cells of the developing kidney.confidentQ8MIP0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006826 [BP]iron ion transportprobableGO:0006810, GO:0006812, GO:0006811, GO:0000041, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0048147 [BP]negative regulation of fibroblast proliferationprobableGO:0042127, GO:0008285, GO:0048145, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0006880 [BP]intracellular sequestering of iron ionprobableGO:0050801, GO:0051238, GO:0042592, GO:0055072, GO:0051651, GO:0051235, GO:0044699, GO:0065007, GO:0065008, GO:0019725, GO:0006879, GO:0006875, GO:0009987, GO:0006873, GO:0044763, GO:0030003, GO:0055065, GO:0055080, GO:0055082, GO:0051179, GO:0051641, GO:0048878, GO:0008150
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0008043 [CC]intracellular ferritin complexprobableGO:0043234, GO:0070288, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0010106 [BP]cellular response to iron ion starvationprobableGO:0009267, GO:0051716, GO:0031669, GO:0033554, GO:0009605, GO:0050896, GO:0009987, GO:0031668, GO:0031667, GO:0008150, GO:0006950, GO:0071496, GO:0044763, GO:0044699, GO:0042594, GO:0007154, GO:0009991
GO:0008199 [MF]ferric iron bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0005506, GO:0046872
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0046427 [BP]positive regulation of JAK-STAT cascadeprobableGO:0023051, GO:0046425, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0010627, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Z6O, chain M
Confidence level:very confident
Coverage over the Query: 1-176
View the alignment between query and template
View the model in PyMOL