Diaphorina citri psyllid: psy15469


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------
MDNRCIPPFENAAFSASVESTNTCGYQNGVPQPTRFCVQSGTHVTANTCDYCYEDTHPVRYLTDLSNTTTWWQSTTMYDGVQWPNQVNITLKFGKTFDVTYVRLLFWSPRPESFAIYKKTYENSSWTPFQFYSASCQETYGLPDDNSGKANDSDTRVFCTSEYSDLSPLTGGAVPFATLEGRYRAKTFSYNLNLQEFVTATEIRITLDRLNTFYDELFLDPSVLRSYFYAIADISVGARCKCNGHASECPYVRQSDGSTRRVCRCEHNTAGPDCNECAPFYNDAPWRRASDDANECR
ccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccEEEEEEEccccEEEEEEEEEEcccccccEEEEEEcccccccEEEEEEcHHHHHHcccccccccccccccccEEEccccccccccccccEEEEccccccccccccccHHHHHHHHHcccEEEEccccccccccccccccccccEEEEEEEEEEEEEEEcccccccccccccccccccEEEccccccccccccccccccccccccccccccccc
*DNRCIPPFENAAFSASVESTNTCGYQNGVPQPTRFCVQSGTHVTANTCDYCYEDTHPVRYLTDLSNTTTWWQSTTMYDGVQWPNQVNITLKFGKTFDVTYVRLLFWSPRPESFAIYKKTYENSSWTPFQFYSASCQETYGLPDD******DSDTRVFCTSEYSDLSPLTGGAVPFATLEGRYRAKTFSYNLNLQEFVTATEIRITLDRLNTFYDELFLDPSVLRSYFYAIADISVGARCKCNGHASECPYVRQSDGSTRRVCRCEHNTAGPDCNECAPFYNDAP************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDNRCIPPFENAAFSASVESTNTCGYQNGVPQPTRFCVQSGTHVTANTCDYCYEDTHPVRYLTDLSNTTTWWQSTTMYDGVQWPNQVNITLKFGKTFDVTYVRLLFWSPRPESFAIYKKTYENSSWTPFQFYSASCQETYGLPDDNSGKANDSDTRVFCTSEYSDLSPLTGGAVPFATLEGRYRAKTFSYNLNLQEFVTATEIRITLDRLNTFYDELFLDPSVLRSYFYAIADISVGARCKCNGHASECPYVRQSDGSTRRVCRCEHNTAGPDCNECAPFYNDAPWRRASDDANECR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Laminin subunit gamma-1 Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.confidentP15215
Laminin-like protein lam-2 confidentQ18823
Laminin subunit gamma-1 Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.confidentP11047

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043208 [MF]glycosphingolipid bindingprobableGO:0005488, GO:0003674, GO:0046625, GO:0008289, GO:0051861
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0007601 [BP]visual perceptionprobableGO:0032501, GO:0044707, GO:0050877, GO:0007600, GO:0050953, GO:0008150, GO:0044699, GO:0003008
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005201 [MF]extracellular matrix structural constituentprobableGO:0003674, GO:0005198
GO:0043259 [CC]laminin-10 complexprobableGO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0043256, GO:0044420, GO:0044421
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQT, chain A
Confidence level:very confident
Coverage over the Query: 1-297
View the alignment between query and template
View the model in PyMOL