Diaphorina citri psyllid: psy15472


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVEGAQCRS
ccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccCEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVE***C**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVEGAQCRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Laminin subunit gamma-1 Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.confidentP15215
Laminin-like protein lam-2 confidentQ18823
Laminin subunit gamma-1 Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.confidentQ1LVF0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043208 [MF]glycosphingolipid bindingprobableGO:0005488, GO:0003674, GO:0046625, GO:0008289, GO:0051861
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0044700 [BP]single organism signalingprobableGO:0008150, GO:0023052, GO:0044699
GO:0005201 [MF]extracellular matrix structural constituentprobableGO:0003674, GO:0005198
GO:0050877 [BP]neurological system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0043229 [CC]intracellular organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0043226
GO:0016477 [BP]cell migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0051674, GO:0044763, GO:0008150, GO:0051179, GO:0044699
GO:0043259 [CC]laminin-10 complexprobableGO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0043256, GO:0044420, GO:0044421
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007154 [BP]cell communicationprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KLO, chain A
Confidence level:very confident
Coverage over the Query: 57-122,182-247
View the alignment between query and template
View the model in PyMOL
Template: 1KLO, chain A
Confidence level:very confident
Coverage over the Query: 22-123,183-211
View the alignment between query and template
View the model in PyMOL
Template: 4AQS, chain A
Confidence level:very confident
Coverage over the Query: 1-122,182-198
View the alignment between query and template
View the model in PyMOL
Template: 2VJ2, chain A
Confidence level:confident
Coverage over the Query: 29-44,57-91,103-139,161-247
View the alignment between query and template
View the model in PyMOL