Psyllid ID: psy15472

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVEGAQCRS
cccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccccccccccEEEcccccccccccHccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccc
cncngfsnrcffdkelynrtghgghcldcqgdrdgpncekcrdnyyqksgdnfctacncnpigslnlqcnsegrcqckpgvtgdkcdrcdvnhydfgeagckscecnpagsvkntpncdsvkgqcesaqlssrgrvhtelrvqsrknfdpagnriwdlrrckrdtyplghggslnlqcnsegrcqckpgvtgdkcdrcdvnhydfgeagckscecnpagsvkntpncdsvkgqceckdnvegaqcrs
cncngfsnRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCesaqlssrgrvhtelrvqsrknfdpagnriwdlrrCKRDTYPLGHggslnlqcnseGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKntpncdsvkgqceckdnvegaqcrs
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVEGAQCRS
****GFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECN******************************************PAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPA*****************************
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGG****QCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVEGAQC**
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNC******************HTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKD*********
C*C*GFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVE***C**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCNPIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDSVKGQCECKDNVEGAQCRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query247 2.2.26 [Sep-21-2011]
P15215 1639 Laminin subunit gamma-1 O yes N/A 0.502 0.075 0.624 3e-42
A0JP86 1592 Laminin subunit gamma-1 O yes N/A 0.493 0.076 0.568 7e-35
Q1LVF0 1593 Laminin subunit gamma-1 O yes N/A 0.497 0.077 0.555 2e-34
Q18823 1633 Laminin-like protein lam- yes N/A 0.453 0.068 0.560 3e-34
P11047 1609 Laminin subunit gamma-1 O yes N/A 0.396 0.060 0.544 1e-32
P02468 1607 Laminin subunit gamma-1 O yes N/A 0.493 0.075 0.504 4e-30
Q9R0B6 1581 Laminin subunit gamma-3 O no N/A 0.493 0.077 0.512 9e-29
Q9Y6N6 1575 Laminin subunit gamma-3 O no N/A 0.493 0.077 0.48 1e-26
Q8HZI9 1190 Laminin subunit gamma-2 O no N/A 0.445 0.092 0.457 4e-23
Q13753 1193 Laminin subunit gamma-2 O no N/A 0.445 0.092 0.457 1e-22
>sp|P15215|LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster GN=LanB2 PE=2 SV=2 Back     alignment and function desciption
 Score =  171 bits (434), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 99/125 (79%), Gaps = 1/125 (0%)

Query: 1   CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCN 60
           CNCNG +++CFFD  L+NRTGHGGHCLDC+ +RDGPNCE+C++N+Y +  D +C  C C+
Sbjct: 359 CNCNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRD-DGYCVNCACD 417

Query: 61  PIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDS 120
           P+GS +LQCNS G+CQCKPGVTGDKCDRCD N+Y FG  GC+ C C+  GS +NTP CD+
Sbjct: 418 PVGSRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNTPACDT 477

Query: 121 VKGQC 125
             G C
Sbjct: 478 ETGIC 482
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Drosophila melanogaster (taxid: 7227)
>sp|A0JP86|LAMC1_XENTR Laminin subunit gamma-1 OS=Xenopus tropicalis GN=lamc1 PE=2 SV=1 Back     alignment and function description
>sp|Q1LVF0|LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio GN=lamc1 PE=2 SV=2 Back     alignment and function description
>sp|Q18823|LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans GN=lam-2 PE=1 SV=3 Back     alignment and function description
>sp|P11047|LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens GN=LAMC1 PE=1 SV=3 Back     alignment and function description
>sp|P02468|LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus GN=Lamc1 PE=1 SV=2 Back     alignment and function description
>sp|Q9R0B6|LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus GN=Lamc3 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y6N6|LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens GN=LAMC3 PE=1 SV=3 Back     alignment and function description
>sp|Q8HZI9|LAMC2_HORSE Laminin subunit gamma-2 OS=Equus caballus GN=LAMC2 PE=2 SV=1 Back     alignment and function description
>sp|Q13753|LAMC2_HUMAN Laminin subunit gamma-2 OS=Homo sapiens GN=LAMC2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
380016777 1621 PREDICTED: LOW QUALITY PROTEIN: laminin 0.299 0.045 0.72 1e-48
383858273 1652 PREDICTED: LOW QUALITY PROTEIN: laminin 0.299 0.044 0.712 1e-48
328776171 1611 PREDICTED: LOW QUALITY PROTEIN: laminin 0.299 0.045 0.712 3e-48
322798888 1523 hypothetical protein SINV_07587 [Solenop 0.299 0.048 0.712 6e-48
332017935 1497 Laminin subunit gamma-1 [Acromyrmex echi 0.299 0.049 0.704 1e-47
340716933 1335 PREDICTED: laminin subunit gamma-1-like 0.299 0.055 0.696 1e-46
340716935 1620 PREDICTED: laminin subunit gamma-1-like 0.299 0.045 0.696 1e-46
350426806 1620 PREDICTED: laminin subunit gamma-1-like 0.299 0.045 0.696 1e-46
340716937 1497 PREDICTED: laminin subunit gamma-1-like 0.299 0.049 0.696 2e-46
307203704 1646 Laminin subunit gamma-1 [Harpegnathos sa 0.299 0.044 0.704 3e-46
>gi|380016777|ref|XP_003692349.1| PREDICTED: LOW QUALITY PROTEIN: laminin subunit gamma-1-like [Apis florea] Back     alignment and taxonomy information
 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%)

Query: 1   CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCN 60
           CNCNG+S RCFFDKELY  TGHGGHCLDC+ +RDG NCE+CR+N+YQ+  DN+C ACNCN
Sbjct: 344 CNCNGYSERCFFDKELYKLTGHGGHCLDCRANRDGANCERCRENFYQRPEDNYCVACNCN 403

Query: 61  PIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDS 120
            IGS +LQCNSEG+CQCKPGVTGDKCD C  N+Y+FG  GC SCECN AGS+ NTPNCD 
Sbjct: 404 EIGSRSLQCNSEGKCQCKPGVTGDKCDHCAANYYNFGSYGCNSCECNTAGSLTNTPNCDP 463

Query: 121 VKGQC 125
           + G C
Sbjct: 464 ISGVC 468

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383858273|ref|XP_003704626.1| PREDICTED: LOW QUALITY PROTEIN: laminin subunit gamma-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328776171|ref|XP_003249128.1| PREDICTED: LOW QUALITY PROTEIN: laminin subunit gamma-1 [Apis mellifera] Back     alignment and taxonomy information
>gi|322798888|gb|EFZ20399.1| hypothetical protein SINV_07587 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332017935|gb|EGI58584.1| Laminin subunit gamma-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340716933|ref|XP_003396945.1| PREDICTED: laminin subunit gamma-1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340716935|ref|XP_003396946.1| PREDICTED: laminin subunit gamma-1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350426806|ref|XP_003494547.1| PREDICTED: laminin subunit gamma-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716937|ref|XP_003396947.1| PREDICTED: laminin subunit gamma-1-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307203704|gb|EFN82670.1| Laminin subunit gamma-1 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query247
FB|FBgn0002528 1639 LanB2 "Laminin B2" [Drosophila 0.502 0.075 0.624 1.5e-47
WB|WBGene00016913 1633 lam-2 [Caenorhabditis elegans 0.542 0.082 0.548 3.4e-43
ZFIN|ZDB-GENE-021226-3 1593 lamc1 "laminin, gamma 1" [Dani 0.497 0.077 0.555 1.5e-40
UNIPROTKB|F1S663 1606 LAMC1 "Uncharacterized protein 0.493 0.075 0.552 2e-40
UNIPROTKB|F1PHK9 1487 LAMC1 "Uncharacterized protein 0.493 0.082 0.536 1.6e-39
UNIPROTKB|F1NI05 1007 LAMC1 "Uncharacterized protein 0.493 0.121 0.528 5.3e-39
UNIPROTKB|F1NK49 1608 LAMC1 "Uncharacterized protein 0.493 0.075 0.528 1.3e-38
UNIPROTKB|F1S0X0 1583 LAMC3 "Uncharacterized protein 0.493 0.077 0.48 1.9e-38
UNIPROTKB|F1MD77 1608 LAMC1 "Uncharacterized protein 0.493 0.075 0.52 2.7e-38
UNIPROTKB|F1N0T1 1585 Bt.54919 "Uncharacterized prot 0.493 0.076 0.48 3.2e-38
FB|FBgn0002528 LanB2 "Laminin B2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 511 (184.9 bits), Expect = 1.5e-47, P = 1.5e-47
 Identities = 78/125 (62%), Positives = 99/125 (79%)

Query:     1 CNCNGFSNRCFFDKELYNRTGHGGHCLDCQGDRDGPNCEKCRDNYYQKSGDNFCTACNCN 60
             CNCNG +++CFFD  L+NRTGHGGHCLDC+ +RDGPNCE+C++N+Y +  D +C  C C+
Sbjct:   359 CNCNGLADKCFFDANLFNRTGHGGHCLDCRENRDGPNCERCKENFYMRD-DGYCVNCACD 417

Query:    61 PIGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGEAGCKSCECNPAGSVKNTPNCDS 120
             P+GS +LQCNS G+CQCKPGVTGDKCDRCD N+Y FG  GC+ C C+  GS +NTP CD+
Sbjct:   418 PVGSRSLQCNSHGKCQCKPGVTGDKCDRCDNNYYQFGPHGCQQCGCDSGGSHQNTPACDT 477

Query:   121 VKGQC 125
               G C
Sbjct:   478 ETGIC 482
GO:0005604 "basement membrane" evidence=ISS;NAS;IDA
GO:0031012 "extracellular matrix" evidence=IDA
GO:0005605 "basal lamina" evidence=IDA
GO:0009887 "organ morphogenesis" evidence=NAS
GO:0009888 "tissue development" evidence=NAS
GO:0048598 "embryonic morphogenesis" evidence=NAS
WB|WBGene00016913 lam-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-021226-3 lamc1 "laminin, gamma 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S663 LAMC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHK9 LAMC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI05 LAMC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NK49 LAMC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S0X0 LAMC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MD77 LAMC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0T1 Bt.54919 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P02468LAMC1_MOUSENo assigned EC number0.5040.49390.0759yesN/A
Q18823LAM2_CAEELNo assigned EC number0.56030.45340.0685yesN/A
Q1LVF0LAMC1_DANRENo assigned EC number0.55550.49790.0772yesN/A
P15215LAMC1_DROMENo assigned EC number0.6240.50200.0756yesN/A
A0JP86LAMC1_XENTRNo assigned EC number0.5680.49390.0766yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 1e-07
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 2e-07
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 3e-07
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 2e-04
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 2e-04
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 4e-04
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 0.003
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information 
 Score = 47.0 bits (112), Expect = 1e-07
 Identities = 21/46 (45%), Positives = 28/46 (60%), Gaps = 1/46 (2%)

Query: 56  ACNCNPIGSLNLQCNSE-GRCQCKPGVTGDKCDRCDVNHYDFGEAG 100
            C+CN  GSL+ QC+   G+C+CKP  TG +CDRC   +Y     G
Sbjct: 1   PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQG 46

Length = 50
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 247
KOG0994|consensus 1758 100.0
KOG0994|consensus 1758 99.97
KOG1836|consensus 1705 99.93
KOG1836|consensus 1705 99.89
KOG3512|consensus 592 99.88
KOG3512|consensus592 99.8
KOG4289|consensus 2531 99.46
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.74
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 98.72
KOG4289|consensus 2531 98.68
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 98.56
KOG1225|consensus 525 98.51
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 98.5
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.47
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 98.33
KOG1225|consensus 525 97.99
KOG1388|consensus217 97.71
KOG1219|consensus 4289 97.61
KOG1226|consensus783 97.39
KOG4260|consensus350 97.26
KOG1226|consensus 783 97.22
smart0005163 DSL delta serrate ligand. 97.04
smart0005163 DSL delta serrate ligand. 96.93
KOG1219|consensus 4289 96.83
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.55
KOG1388|consensus217 96.46
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 96.43
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.37
KOG3509|consensus964 96.25
KOG3509|consensus964 96.21
KOG4260|consensus 350 95.89
KOG1218|consensus316 95.31
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 94.9
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 94.44
KOG1218|consensus316 94.22
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 93.85
KOG1217|consensus487 93.04
PF0000832 EGF: EGF-like domain This is a sub-family of the P 92.08
KOG0196|consensus 996 88.78
PTZ00214800 high cysteine membrane protein Group 4; Provisiona 88.26
smart0017939 EGF_CA Calcium-binding EGF-like domain. 88.01
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 87.51
KOG1217|consensus 487 87.19
cd0018598 TNFR Tumor necrosis factor receptor (TNFR) domain; 84.52
KOG0196|consensus 996 83.28
cd0005336 EGF Epidermal growth factor domain, found in epide 81.62
>KOG0994|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.9e-36  Score=284.83  Aligned_cols=185  Identities=39%  Similarity=1.063  Sum_probs=169.0

Q ss_pred             CCCCCCCCCcccchhhhcccC--CCeeccCCCCCCCCCCCCCCCCCCccCC-----CCCCCcCCCCCCCCCCCc-CC---
Q psy15472          1 CNCNGFSNRCFFDKELYNRTG--HGGHCLDCQGDRDGPNCEKCRDNYYQKS-----GDNFCTACNCNPIGSLNL-QC---   69 (247)
Q Consensus         1 c~C~~h~~~C~~~~~~~~~~~--~~g~C~~C~~~~~G~~Ce~C~~Gy~g~~-----~~~~C~~C~C~~~g~~~~-~c---   69 (247)
                      |+||+|+.+|+||+.++.++|  ++|||.+|+|||+|.+||+|+|.||+++     .+.+|++|.|++.|+... .|   
T Consensus       339 C~CNgHa~sCHFD~aV~~ASG~vSGGVCDdCqHNT~G~~CE~CkP~fYRdprr~i~~p~vC~pC~CdP~GS~~~g~cds~  418 (1758)
T KOG0994|consen  339 CECNGHADTCHFDMAVYEASGNVSGGVCDDCQHNTEGQNCERCKPFFYRDPRRDISDPDVCKPCECDPAGSQDGGICDSF  418 (1758)
T ss_pred             cCCCCCcccccccHHHHhhcCCcccccCccccccccccchhhcCcccccCCCCCCCCccccccccCCCCcCcCCCccccc
Confidence            789999999999999999998  7999999999999999999999999986     578999999999998753 44   


Q ss_pred             -CC-C----ceeeCCCCCcCCCCCCCCCCcccCC---CCCcccccCCCCCCCCCCCCCcCCCCceeccCCCCCCccceee
Q psy15472         70 -NS-E----GRCQCKPGVTGDKCDRCDVNHYDFG---EAGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTEL  140 (247)
Q Consensus        70 -~~-~----g~C~C~~g~~G~~C~~C~~G~~g~~---~~~C~~C~C~~~g~~~~~~~C~~~tG~C~c~~~~~~g~~~~~~  140 (247)
                       +. +    |+|.||+++.|.+|++|.+||||+.   ..+|++|.|++.|++.+++ ||+.||                 
T Consensus       419 ~Dp~~GlvaGqC~CK~~V~G~RCd~Ck~Gywgl~~~dp~GC~~C~CN~lGT~~~s~-CD~~TG-----------------  480 (1758)
T KOG0994|consen  419 CDPSTGLVAGQCRCKEHVAGRRCDRCKDGYWGLTSADPYGCRPCDCNPLGTRNGSG-CDPETG-----------------  480 (1758)
T ss_pred             cCccccccccccccccCcCccccchhccCcccCccCCCCCccccccccccccCCCC-CCCCCC-----------------
Confidence             32 3    9999999999999999999999987   4689999999999988764 888887                 


Q ss_pred             eeccccCcCCCCCccccCCCCCCCCCCCCCCCCCCccCCCCccccCCCCcccCCCCCCCCCcccCC--CCCCccCCCCCC
Q psy15472        141 RVQSRKNFDPAGNRIWDLRRCKRDTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFG--EAGCKSCECNPA  218 (247)
Q Consensus       141 ~~~~~~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~~~C~~~G~C~C~~g~~G~~C~~C~~g~~g~~--~~~C~~C~C~~~  218 (247)
                                                                .|.|++-++|..|++|.|.|||++  ..+|.+|.|+.+
T Consensus       481 ------------------------------------------~C~ckrlvTg~~cdqclPeh~gLs~~~~gc~~cdcd~G  518 (1758)
T KOG0994|consen  481 ------------------------------------------DCYCKRLVTGIDCDQCLPEHWGLSNDLEGCRPCDCDQG  518 (1758)
T ss_pred             ------------------------------------------ceEeeccccCCCccccCccccccCCCCCCCcccccCCC
Confidence                                                      788889999999999999999998  789999999999


Q ss_pred             CCCCCCCCCCCCCCeeeCCCCCCCCCCCC
Q psy15472        219 GSVKNTPNCDSVKGQCECKDNVEGAQCRS  247 (247)
Q Consensus       219 g~~~~~~~C~~~tG~C~C~~g~~G~~C~~  247 (247)
                      |+.  ..+|+..+|+|.|+++|.|++|++
T Consensus       519 Gs~--d~sc~~~sGqC~CRe~~~GR~c~~  545 (1758)
T KOG0994|consen  519 GSY--DNSCDLHSGQCECREHMLGRRCEQ  545 (1758)
T ss_pred             CCC--CcccccccCccccccccccccccc
Confidence            998  567999999999999999999974

>KOG0994|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PTZ00214 high cysteine membrane protein Group 4; Provisional Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>cd00185 TNFR Tumor necrosis factor receptor (TNFR) domain; superfamily of TNF-like receptor domains Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 1e-16
4aqt_A375 Laminin Gamma1 Ln-Le1-2 Structure Length = 375 1e-10
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 4e-05
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 5e-05
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure 
Iteration: 1

 Score = 83.2 bits (204), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 74/218 (33%), Positives = 100/218 (45%), Gaps = 31/218 (14%)
Query: 1   CNCNGFSNRCFFDKELYNRTGH--GGHCLDCQGDRDGPNCEKCRDNYYQKS-----GDNF 53
           CNCN  S+ C FD  ++  TG+  GG C +CQ +  G NCE+C+  Y+Q         N 
Sbjct: 318 CNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNL 377
Query: 54  CTACNCNPIGSLNLQC----------NSEGRCQCKPGVTGDKCDRCDVNHYDFGEA---G 100
           C  C C+P GS N                G+C+CK  V G++CD C    YD       G
Sbjct: 378 CEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYG 437
Query: 101 CKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRR 160
           CKSC CNP G++     CDS  G C   +L +  R    L      + D  G      R 
Sbjct: 438 CKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDG-----CRP 492
Query: 161 CKRDTYPLGHGGSLNLQCNSE-GRCQCKPGVTGDKCDR 197
           C  D      GG+LN  C+ + G+C C P + G +C+ 
Sbjct: 493 CDCDL-----GGALNNSCSEDSGQCSCLPHMIGRQCNE 525
>pdb|4AQT|A Chain A, Laminin Gamma1 Ln-Le1-2 Structure Length = 375 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query247
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-21
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-20
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-16
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 3e-13
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 8e-12
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 3e-08
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-12
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 7e-12
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 1e-08
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 6e-08
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 4e-05
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 4e-09
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 5e-06
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 4e-04
2y38_A403 Laminin subunit alpha-5; structural protein, cell 4e-07
2y38_A403 Laminin subunit alpha-5; structural protein, cell 2e-06
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 8e-05
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 8e-04
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
 Score = 91.7 bits (227), Expect = 2e-21
 Identities = 71/272 (26%), Positives = 98/272 (36%), Gaps = 29/272 (10%)

Query: 1   CNCNGFSNRCFFDKELYNRTGHGGHCL-DCQGDRDGPNCEKCRDNYYQKS-------GDN 52
           C C G ++ C     +        H    C+ +  G NCE C D Y+            N
Sbjct: 254 CFCYGHASECAPVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSN 313

Query: 53  FCTACNCNPIGS---------LNLQCNSEGRCQ-CKPGVTGDKCDRCDVNHYDFGEAG-- 100
            C  CNCN   S         L     S G C  C+    G  C++C   ++   E    
Sbjct: 314 ACKKCNCNEHSSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIR 373

Query: 101 ----CKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIW 156
               C+ C C+PAGS                     R ++H E                 
Sbjct: 374 DPNLCEPCTCDPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAE 433

Query: 157 DLRRCKR-DTYPLGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFGE--AGCKSC 213
           D   CK     PLG     N   +  G C CK  VTG +CD+C   H+       GC+ C
Sbjct: 434 DPYGCKSCACNPLGTIPGGNPCDSETGYCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPC 493

Query: 214 ECNPAGSVKNTPNCDSVKGQCECKDNVEGAQC 245
           +C+  G++ N+  C    GQC C  ++ G QC
Sbjct: 494 DCDLGGALNNS--CSEDSGQCSCLPHMIGRQC 523
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.93
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.92
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.89
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.85
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.64
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.62
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.53
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.46
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 99.39
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.35
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.18
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 99.13
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.1
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.1
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.09
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.97
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.81
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.76
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.69
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.63
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.58
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.46
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.32
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.23
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.09
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 97.79
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 97.75
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.59
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 97.58
2bou_A143 EGF-like module containing mucin-like hormone rece 97.42
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.3
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.26
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 97.09
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 96.94
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.88
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 96.71
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 96.29
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 96.0
2bou_A143 EGF-like module containing mucin-like hormone rece 95.72
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 95.55
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 95.48
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 95.45
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 95.19
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 95.18
1a3p_A45 Epidermal growth factor; disulfide connectivities, 94.73
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 94.71
1a3p_A45 Epidermal growth factor; disulfide connectivities, 94.64
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 94.61
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 94.58
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 94.46
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 94.32
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 93.91
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 93.69
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 93.32
1aut_L114 Activated protein C; serine proteinase, plasma cal 93.27
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 92.99
2vh0_B134 Activated factor XA light chain; serine protease, 92.15
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 91.48
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 91.25
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 91.22
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 91.1
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 91.02
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 90.69
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 90.07
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 89.7
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 89.58
1nql_B53 Epidermal growth factor; cell surface receptor, ty 89.52
2k2s_B61 Micronemal protein 6; microneme protein complex, c 89.2
2hey_R146 Tumor necrosis factor receptor superfamily member; 89.17
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 89.03
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 87.97
2uwi_A142 CRME protein; receptor, poxvirus TNF receptor, rec 87.56
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 87.51
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 86.72
2k2s_B61 Micronemal protein 6; microneme protein complex, c 86.28
1nql_B53 Epidermal growth factor; cell surface receptor, ty 86.11
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 85.34
2vh0_B134 Activated factor XA light chain; serine protease, 84.7
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 83.89
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 83.46
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 83.25
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 83.11
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 82.61
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 82.27
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 82.25
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 81.05
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 80.83
1jma_B167 Herpesvirus entry mediator; V-type IG molecule and 80.69
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 80.65
1sg1_X161 Tumor necrosis factor receptor superfamily member 80.49
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 80.4
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 80.22
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
Probab=99.93  E-value=8.8e-27  Score=184.35  Aligned_cols=131  Identities=35%  Similarity=0.867  Sum_probs=108.3

Q ss_pred             CCeeccCCCCCCCCCCCCCCCCCCccCCCC-----CCCcCCCCCCCCCCC--cCCCC-Cceee-CCCCCcCCCCCCCCCC
Q psy15472         22 HGGHCLDCQGDRDGPNCEKCRDNYYQKSGD-----NFCTACNCNPIGSLN--LQCNS-EGRCQ-CKPGVTGDKCDRCDVN   92 (247)
Q Consensus        22 ~~g~C~~C~~~~~G~~Ce~C~~Gy~g~~~~-----~~C~~C~C~~~g~~~--~~c~~-~g~C~-C~~g~~G~~C~~C~~G   92 (247)
                      ..++|++|++||+|++||+|++||||.+..     ..|++|+|+++++.+  ..|+. +|+|+ |+++|+|++|++|++|
T Consensus        16 g~~~C~~C~~g~~G~~Ce~C~~g~~g~~~~~~~~~~~C~~C~C~~~~~~~~~~~C~~~tG~C~~C~~g~~G~~Ce~C~~G   95 (162)
T 1klo_A           16 KEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEG   95 (162)
T ss_dssp             CCEEECSCCTTEESTTSCEECTTEEEETTCTTSSCEEEEECCSTTCBCTTCSCCBCTTTCCBCCBCTTEETTTTCEECTT
T ss_pred             CCEEeCCCCCCCcCCCCcCCCCCCcCCcccccCCCCCCeeCcCCCCCCcccCCcccCCCCcccCCCCCCcCCCcCcCchh
Confidence            368997799999999999999999997643     579999999876432  46776 89996 9999999999999999


Q ss_pred             cccCCC-----CCcccccCCCCCCCCCCCCCcCCCCceeccCCCCCCccceeeeeccccCcCCCCCccccCCCCCCCCCC
Q psy15472         93 HYDFGE-----AGCKSCECNPAGSVKNTPNCDSVKGQCESAQLSSRGRVHTELRVQSRKNFDPAGNRIWDLRRCKRDTYP  167 (247)
Q Consensus        93 ~~g~~~-----~~C~~C~C~~~g~~~~~~~C~~~tG~C~c~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~~~~  167 (247)
                      |||.+.     ..|++|+|++.++......|++++|                                            
T Consensus        96 y~g~~~~~~~~~~C~~C~C~~~Gs~~~~~~Cd~~tG--------------------------------------------  131 (162)
T 1klo_A           96 FFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVTG--------------------------------------------  131 (162)
T ss_dssp             EEECTTCSSGGGSEEECCCCTTTBGGGCCCCCTTTC--------------------------------------------
T ss_pred             hcCCccccCCCCCCeeccCCCCCccCCCCCCCCCCC--------------------------------------------
Confidence            999762     3689999998876543234666655                                            


Q ss_pred             CCCCCCCCccCCCCccccCCCCcccCCCCCCCCCcccCC-CCCCc
Q psy15472        168 LGHGGSLNLQCNSEGRCQCKPGVTGDKCDRCDVNHYDFG-EAGCK  211 (247)
Q Consensus       168 ~~~~~~~~~~C~~~G~C~C~~g~~G~~C~~C~~g~~g~~-~~~C~  211 (247)
                                     +|+|+++|+|++||+|++|||++. ..+|+
T Consensus       132 ---------------~C~C~~g~~G~~Cd~C~~g~~g~~~~~GC~  161 (162)
T 1klo_A          132 ---------------QCQCLPHVSGRDCGTCDPGYYNLQSGQGCE  161 (162)
T ss_dssp             ---------------CCCBCTTEESTTCCEECTTCBCGGGSSCCB
T ss_pred             ---------------EeECCCCCcCCCCCCCCCCcccCCCCCCcC
Confidence                           889999999999999999999997 34554
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2uwi_A CRME protein; receptor, poxvirus TNF receptor, receptor immunomodulator, TNF alpha receptor; 2.0A {Vaccinia virus} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1jma_B Herpesvirus entry mediator; V-type IG molecule and TNFR superfamily, viral protein; HET: NAG; 2.65A {Human herpesvirus 1} SCOP: g.24.1.1 g.24.1.1 PDB: 2aw2_B* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1sg1_X Tumor necrosis factor receptor superfamily member 16; nerve growth factor, NGF, neurotrophin, common neurotrophin receptor; 2.40A {Rattus norvegicus} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 g.24.1.1 PDB: 3buk_C* 3ij2_X Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 247
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 1e-04
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 0.001
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 36.4 bits (84), Expect = 1e-04
 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%)

Query: 57 CNCNPIGSLNLQCNSE---GRCQCKPGVTGDKCDRCDVNHYDF 96
          C CNP G++  Q +     G+CQC P V+G  C  CD  +Y+ 
Sbjct: 1  CACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNL 43
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query247
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.96
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.84
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.82
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.8
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.56
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.2
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.88
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 96.81
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 96.8
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 96.8
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.78
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.76
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 96.59
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 96.51
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 96.5
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 96.42
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.3
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 95.96
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 95.87
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.76
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 95.53
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 95.49
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 95.38
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 95.27
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 95.1
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 94.95
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 94.82
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 94.6
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 94.58
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 94.42
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 93.03
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 92.72
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 92.55
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 92.26
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 91.99
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 91.27
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 91.03
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 90.85
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 90.53
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 90.0
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 86.94
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 86.92
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 85.52
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 85.04
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 84.03
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 83.72
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 80.5
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.96  E-value=1.5e-10  Score=71.39  Aligned_cols=26  Identities=42%  Similarity=1.082  Sum_probs=24.2

Q ss_pred             CccccCCCCcccCCCCCCCCCcccCC
Q psy15472        181 EGRCQCKPGVTGDKCDRCDVNHYDFG  206 (247)
Q Consensus       181 ~G~C~C~~g~~G~~C~~C~~g~~g~~  206 (247)
                      +|+|.|+++|+|++||+|+++||++.
T Consensus        19 tGqC~Ck~~v~G~~Cd~C~~g~~~~~   44 (51)
T d1kloa3          19 TGQCQCLPHVSGRDCGTCDPGYYNLQ   44 (51)
T ss_dssp             TCCCCBCTTEESTTCCEECTTCBCGG
T ss_pred             CCeecCCCCCcCCCcccccccccCCC
Confidence            45999999999999999999999987
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure