Diaphorina citri psyllid: psy15473

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190

MFRRCICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQGPCVQLDDDQVSNLGNRTRIRIKSALGGNRTRGLALTRQTHYQLTGYHHEPTSGGAFSRCVPCNCNGHADICDAESGRCICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQGPCVQLDDDQVVCSECPRGYGGEKMSPGAQ

ccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

MFRRCICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQGPCVQLDDDQVSNLGNRTRIRIKSALGGNRTRGLALTRQTHYQLTGYHHEPTSGGAFSRCVPCNCNGHADICDAESGRCICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQGPCVQLDDDQVVCSECPRGYGGEKMSPG**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MFRRCICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQGPCVQLDDDQVSNLGNRTRIRIKSALGGNRTRGLALTRQTHYQLTGYHHEPTSGGAFSRCVPCNCNGHADICDAESGRCICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQGPCVQLDDDQVVCSECPRGYGGEKMSPGAQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Laminin subunit gamma-1	Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.	confident	A0JP86
Laminin subunit gamma-1	Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.	confident	Q1LVF0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0070062 [CC]	extracellular vesicular exosome	probable	GO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0019219 [BP]	regulation of nucleobase-containing compound metabolic process	probable	GO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0048518 [BP]	positive regulation of biological process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0031175 [BP]	neuron projection development	probable	GO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0043256 [CC]	laminin complex	probable	GO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0044464 [CC]	cell part	probable	GO:0005575, GO:0005623
GO:0005615 [CC]	extracellular space	probable	GO:0005575, GO:0005576, GO:0044421
GO:0060255 [BP]	regulation of macromolecule metabolic process	probable	GO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0009653 [BP]	anatomical structure morphogenesis	probable	GO:0032502, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1KLO, chain A
Confidence level:very confident
Coverage over the Query: 38-190
View the alignment between query and template
View the model in PyMOL

Template: 1KLO, chain A
Confidence level:very confident
Coverage over the Query: 3-49,60-145
View the alignment between query and template
View the model in PyMOL