Psyllid ID: psy15473
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| 321466184 | 1626 | hypothetical protein DAPPUDRAFT_321711 [ | 0.226 | 0.026 | 0.718 | 1e-35 | |
| 328717117 | 1319 | PREDICTED: laminin subunit gamma-1-like | 0.378 | 0.054 | 0.702 | 2e-34 | |
| 328717115 | 1631 | PREDICTED: laminin subunit gamma-1-like | 0.378 | 0.044 | 0.702 | 2e-34 | |
| 194868030 | 1639 | laminin B2 [Drosophila erecta] gi|190653 | 0.389 | 0.045 | 0.625 | 3e-32 | |
| 195326389 | 1639 | LanB2 [Drosophila sechellia] gi|19411885 | 0.389 | 0.045 | 0.625 | 5e-32 | |
| 195490762 | 1639 | laminin B2 [Drosophila yakuba] gi|194179 | 0.389 | 0.045 | 0.625 | 6e-32 | |
| 17737557 | 1639 | laminin B2 [Drosophila melanogaster] gi| | 0.389 | 0.045 | 0.625 | 6e-32 | |
| 157804 | 1639 | laminin B2 chain [Drosophila melanogaste | 0.389 | 0.045 | 0.625 | 6e-32 | |
| 226113 | 1296 | laminin B2 | 0.389 | 0.057 | 0.625 | 6e-32 | |
| 195428901 | 1645 | GK16620 [Drosophila willistoni] gi|19415 | 0.389 | 0.044 | 0.635 | 3e-31 |
| >gi|321466184|gb|EFX77181.1| hypothetical protein DAPPUDRAFT_321711 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 155 bits (391), Expect = 1e-35, Method: Compositional matrix adjust.
Identities = 69/96 (71%), Positives = 79/96 (82%)
Query: 89 GYHHEPTSGGAFSRCVPCNCNGHADICDAESGRCICQDNTGGDNCERCARGYYGNALEGA 148
G+ HEP +GG F+RCVPCNCNGHADICDAESGRCICQ NT GDNCERCARG+YGNAL+G+
Sbjct: 715 GFRHEPANGGPFARCVPCNCNGHADICDAESGRCICQHNTAGDNCERCARGFYGNALQGS 774
Query: 149 VTDCKQCPCPNQGPCVQLDDDQVVCSECPRGYGGEK 184
DC CPCPN G C++L D+ VVC ECP GY G +
Sbjct: 775 PNDCNPCPCPNGGACIELADETVVCLECPVGYAGPR 810
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328717117|ref|XP_003246126.1| PREDICTED: laminin subunit gamma-1-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328717115|ref|XP_001944333.2| PREDICTED: laminin subunit gamma-1-like isoform 3 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|194868030|ref|XP_001972200.1| laminin B2 [Drosophila erecta] gi|190653983|gb|EDV51226.1| laminin B2 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195326389|ref|XP_002029911.1| LanB2 [Drosophila sechellia] gi|194118854|gb|EDW40897.1| LanB2 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195490762|ref|XP_002093277.1| laminin B2 [Drosophila yakuba] gi|194179378|gb|EDW92989.1| laminin B2 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|17737557|ref|NP_524006.1| laminin B2 [Drosophila melanogaster] gi|2506807|sp|P15215.2|LAMC1_DROME RecName: Full=Laminin subunit gamma-1; AltName: Full=Laminin B2 chain; Flags: Precursor gi|157806|gb|AAA28665.1| laminin B2 chain [Drosophila melanogaster] gi|7294908|gb|AAF50238.1| laminin B2 [Drosophila melanogaster] gi|60678071|gb|AAX33542.1| LD15803p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|157804|gb|AAA28664.1| laminin B2 chain [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|226113|prf||1410326A laminin B2 | Back alignment and taxonomy information |
|---|
| >gi|195428901|ref|XP_002062504.1| GK16620 [Drosophila willistoni] gi|194158589|gb|EDW73490.1| GK16620 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 190 | ||||||
| FB|FBgn0002528 | 1639 | LanB2 "Laminin B2" [Drosophila | 0.505 | 0.058 | 0.625 | 8.6e-42 | |
| WB|WBGene00016913 | 1633 | lam-2 [Caenorhabditis elegans | 0.510 | 0.059 | 0.546 | 2.4e-35 | |
| UNIPROTKB|F1MD77 | 1608 | LAMC1 "Uncharacterized protein | 0.515 | 0.060 | 0.494 | 1.1e-30 | |
| UNIPROTKB|F1PHK9 | 1487 | LAMC1 "Uncharacterized protein | 0.515 | 0.065 | 0.474 | 2.4e-30 | |
| UNIPROTKB|F1S663 | 1606 | LAMC1 "Uncharacterized protein | 0.515 | 0.061 | 0.474 | 4.7e-30 | |
| MGI|MGI:99914 | 1607 | Lamc1 "laminin, gamma 1" [Mus | 0.515 | 0.060 | 0.464 | 1.6e-29 | |
| UNIPROTKB|P11047 | 1609 | LAMC1 "Laminin subunit gamma-1 | 0.515 | 0.060 | 0.454 | 2.6e-29 | |
| UNIPROTKB|F1MAA7 | 1607 | Lamc1 "Protein Lamc1" [Rattus | 0.515 | 0.060 | 0.464 | 5.3e-29 | |
| UNIPROTKB|F1NI05 | 1007 | LAMC1 "Uncharacterized protein | 0.505 | 0.095 | 0.463 | 1.2e-28 | |
| MGI|MGI:99892 | 3084 | Lama1 "laminin, alpha 1" [Mus | 0.494 | 0.030 | 0.458 | 2.6e-28 |
| FB|FBgn0002528 LanB2 "Laminin B2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 406 (148.0 bits), Expect = 8.6e-42, Sum P(2) = 8.6e-42
Identities = 60/96 (62%), Positives = 78/96 (81%)
Query: 89 GYHHEPTSGGAFSRCVPCNCNGHADICDAESGRCICQDNTGGDNCERCARGYYGNALEGA 148
GY H P GG F C+PC+C+GHADICD+E+GRCICQ NT GDNC++CA+G+YGNAL G
Sbjct: 727 GYRHSPARGGPFMPCIPCDCHGHADICDSETGRCICQHNTHGDNCDQCAKGFYGNALGGT 786
Query: 149 VTDCKQCPCPNQGPCVQLDDDQVVCSECPRGYGGEK 184
DCK+CPCPN G C+Q+++D V+C+ECP+GY G +
Sbjct: 787 PNDCKRCPCPNDGACLQINEDTVICTECPKGYFGSR 822
|
|
| WB|WBGene00016913 lam-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MD77 LAMC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PHK9 LAMC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S663 LAMC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99914 Lamc1 "laminin, gamma 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P11047 LAMC1 "Laminin subunit gamma-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MAA7 Lamc1 "Protein Lamc1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NI05 LAMC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:99892 Lama1 "laminin, alpha 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 3e-09 | |
| pfam00053 | 49 | pfam00053, Laminin_EGF, Laminin EGF-like (Domains | 2e-07 | |
| smart00180 | 46 | smart00180, EGF_Lam, Laminin-type epidermal growth | 1e-06 | |
| cd00055 | 50 | cd00055, EGF_Lam, Laminin-type epidermal growth fa | 0.001 |
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
Score = 50.4 bits (121), Expect = 3e-09
Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 3/46 (6%)
Query: 105 PCNCNGHADI---CDAESGRCICQDNTGGDNCERCARGYYGNALEG 147
PC+CNGH + CD +G+C C+ NT G C+RCA GYYG +G
Sbjct: 1 PCDCNGHGSLSGQCDPGTGQCECKPNTTGRRCDRCAPGYYGLPSQG 46
|
Length = 50 |
| >gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) | Back alignment and domain information |
|---|
| >gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| KOG0994|consensus | 1758 | 99.9 | ||
| KOG0994|consensus | 1758 | 99.82 | ||
| KOG3512|consensus | 592 | 99.71 | ||
| KOG1836|consensus | 1705 | 99.7 | ||
| KOG1836|consensus | 1705 | 99.54 | ||
| KOG3512|consensus | 592 | 99.36 | ||
| KOG1219|consensus | 4289 | 99.23 | ||
| KOG4289|consensus | 2531 | 99.03 | ||
| KOG4289|consensus | 2531 | 98.93 | ||
| KOG1225|consensus | 525 | 98.85 | ||
| KOG1226|consensus | 783 | 98.59 | ||
| KOG1219|consensus | 4289 | 98.57 | ||
| KOG1225|consensus | 525 | 98.52 | ||
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 98.51 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 98.37 | |
| KOG1214|consensus | 1289 | 98.34 | ||
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 98.32 | |
| cd00055 | 50 | EGF_Lam Laminin-type epidermal growth factor-like | 98.07 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 98.03 | |
| smart00180 | 46 | EGF_Lam Laminin-type epidermal growth factor-like | 98.02 | |
| KOG4260|consensus | 350 | 98.02 | ||
| PF00053 | 49 | Laminin_EGF: Laminin EGF-like (Domains III and V); | 97.92 | |
| KOG1217|consensus | 487 | 97.91 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 97.61 | |
| KOG1217|consensus | 487 | 97.48 | ||
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 97.32 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 97.21 | |
| KOG4260|consensus | 350 | 97.21 | ||
| KOG3509|consensus | 964 | 97.15 | ||
| KOG1226|consensus | 783 | 96.79 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.72 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 96.67 | |
| smart00051 | 63 | DSL delta serrate ligand. | 96.56 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 96.53 | |
| KOG3509|consensus | 964 | 96.51 | ||
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 96.47 | |
| smart00051 | 63 | DSL delta serrate ligand. | 96.45 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.34 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 96.14 | |
| KOG1214|consensus | 1289 | 96.02 | ||
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 95.98 | |
| KOG1388|consensus | 217 | 95.3 | ||
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 95.05 | |
| KOG1218|consensus | 316 | 94.65 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 94.2 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 93.65 | |
| KOG1218|consensus | 316 | 93.55 | ||
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 92.66 | |
| smart00181 | 35 | EGF Epidermal growth factor-like domain. | 90.6 | |
| KOG0196|consensus | 996 | 88.15 | ||
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 88.0 | |
| PHA02887 | 126 | EGF-like protein; Provisional | 87.12 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 86.63 | |
| PHA03099 | 139 | epidermal growth factor-like protein (EGF-like pro | 85.14 | |
| KOG0196|consensus | 996 | 83.38 | ||
| KOG1388|consensus | 217 | 83.21 | ||
| KOG3514|consensus | 1591 | 80.67 |
| >KOG0994|consensus | Back alignment and domain information |
|---|
Probab=99.90 E-value=6e-24 Score=184.88 Aligned_cols=162 Identities=38% Similarity=0.854 Sum_probs=132.2
Q ss_pred CceeecCCCCCCCCCccCCCCcccCCCCCCCCCCcCCCCCCCCCceecCCcccccCCCceeEeecCCCCCCCCCCccccC
Q psy15473 2 FRRCICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQGPCVQLDDDQVSNLGNRTRIRIKSALGGNRTRGLALTR 81 (190)
Q Consensus 2 ~~~C~C~~g~~G~~C~~C~~g~~g~~c~~~~~~C~~~~C~~~g~C~~~~~~~~~~~~~~~~c~c~~~~~g~~c~~~~~~~ 81 (190)
.|+|+|++|..|..|++|+||+||..-++ |.++.|+.-|+-..+-+.. ..+|.|.++.- ++
T Consensus 781 GGqCqCkPnVVGR~CdqCApGtyGFGPsG----Ck~CdC~~~Gs~~~~Cd~~------tGQC~C~~g~y---------gr 841 (1758)
T KOG0994|consen 781 GGQCQCKPNVVGRRCDQCAPGTYGFGPSG----CKACDCNSIGSLDKYCDKI------TGQCQCRPGTY---------GR 841 (1758)
T ss_pred CceecccCccccccccccCCcccCcCCcc----Ccccccccccccccccccc------ccceeeccccc---------hh
Confidence 47899999999999999999999998554 9999999877644433221 14566665544 46
Q ss_pred CCccCCCCcccCCCCCCCCCCcccCCCcCCCCCccCCCCee-eCCCCCCCCCCccCCCCcccCCCCCCCCCCcCCCCCCC
Q psy15473 82 QTHYQLTGYHHEPTSGGAFSRCVPCNCNGHADICDAESGRC-ICQDNTGGDNCERCARGYYGNALEGAVTDCKQCPCPNQ 160 (190)
Q Consensus 82 ~~~~C~~G~~g~~~~~~~~~~C~~c~C~~~~~~C~~~~g~C-~C~~g~~G~~C~~C~~G~~g~~c~~~~~~C~~~~C~~~ 160 (190)
+|..|.|||||. ++|.+|+|++|+++|++++|.| .|+..++|..|+.|+.||||++--..-..|.|+||..+
T Consensus 842 qCnqCqpG~WgF-------PeCr~CqCNgHA~~Cd~~tGaCi~CqD~T~G~~CdrCl~GyyGdP~lg~g~~CrPCpCP~g 914 (1758)
T KOG0994|consen 842 QCNQCQPGYWGF-------PECRPCQCNGHADTCDPITGACIDCQDSTTGHSCDRCLDGYYGDPRLGSGIGCRPCPCPDG 914 (1758)
T ss_pred hccccCCCccCC-------CcCccccccCcccccCccccccccccccccccchhhhhccccCCcccCCCCCCCCCCCCCC
Confidence 678899999984 6799999999999999999999 59999999999999999999987665566999999765
Q ss_pred C--------Cceec-CCCCeeeCCCCCCCCCCCCCCCCC
Q psy15473 161 G--------PCVQL-DDDQVVCSECPRGYGGEKMSPGAQ 190 (190)
Q Consensus 161 g--------~C~~~-~~~~~~C~~C~~G~~G~~C~~c~~ 190 (190)
. +|+.. ....-.| .|++||.|.+|+.||+
T Consensus 915 p~Sg~~~A~sC~~d~~t~~ivC-~C~~GY~G~RCe~CA~ 952 (1758)
T KOG0994|consen 915 PASGRQHADSCYLDTRTQQIVC-HCQEGYSGSRCEICAD 952 (1758)
T ss_pred Cccchhccccccccccccceee-ecccCccccchhhhcc
Confidence 2 46543 2234799 9999999999999985
|
|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >KOG3512|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG3509|consensus | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >KOG1388|consensus | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >smart00181 EGF Epidermal growth factor-like domain | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >PHA02887 EGF-like protein; Provisional | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >PHA03099 epidermal growth factor-like protein (EGF-like protein); Provisional | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG1388|consensus | Back alignment and domain information |
|---|
| >KOG3514|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 190 | ||||
| 2y38_A | 403 | Laminin Alpha5 Chain N-Terminal Fragment Length = 4 | 5e-05 | ||
| 1klo_A | 162 | Crystal Structure Of Three Consecutive Laminin-Type | 2e-04 | ||
| 1klo_A | 162 | Crystal Structure Of Three Consecutive Laminin-Type | 4e-04 | ||
| 1npe_B | 164 | Crystal Structure Of Nidogen/laminin Complex Length | 2e-04 | ||
| 1npe_B | 164 | Crystal Structure Of Nidogen/laminin Complex Length | 5e-04 |
| >pdb|2Y38|A Chain A, Laminin Alpha5 Chain N-Terminal Fragment Length = 403 | Back alignment and structure |
|
| >pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 | Back alignment and structure |
| >pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 | Back alignment and structure |
| >pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 | Back alignment and structure |
| >pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 190 | |||
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-12 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-09 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 2e-06 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 1e-11 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 6e-11 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 4e-05 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 5e-04 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 9e-10 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 5e-09 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 1e-08 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 2e-04 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 3e-04 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 3e-07 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 5e-07 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 1e-05 |
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
Score = 61.0 bits (148), Expect = 2e-12
Identities = 35/147 (23%), Positives = 49/147 (33%), Gaps = 19/147 (12%)
Query: 5 CICQDNTGGDNCERCARGYYGN--ALEGAVTDCKQCPCPNQGPCVQLDDDQVSNLGNRTR 62
C T G CE C GY+G+ G V C+ C C + D NR
Sbjct: 21 THCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNI------DPNAVGNCNRLT 74
Query: 63 IRIKSALGGNRTRGLALTRQTHYQLTGYHHEPTSGGAFSRCVPCNCNGH-----ADICDA 117
+ T G G+ P + +C C CN + C+
Sbjct: 75 GECLKCIYN--TAG----FYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNP 128
Query: 118 ESGRCICQDNTGGDNCERCARGYYGNA 144
+G+C C + G +C C GYY
Sbjct: 129 VTGQCQCLPHVSGRDCGTCDPGYYNLQ 155
|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 99.86 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 99.84 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 99.82 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.7 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.56 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.55 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.52 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.49 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.46 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 99.42 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.39 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 99.36 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.34 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.3 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.27 | |
| 2y38_A | 403 | Laminin subunit alpha-5; structural protein, cell | 99.17 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 99.16 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 99.15 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.13 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.13 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 99.11 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 99.1 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 99.07 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 99.02 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.01 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.96 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.92 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 98.91 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.91 | |
| 4aqt_A | 375 | Laminin subunit gamma-1; cell adhesion; HET: NAG B | 98.9 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.89 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.83 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.78 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.73 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.65 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.63 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.59 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 98.54 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.53 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 98.32 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.19 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 98.18 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.18 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 98.16 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 98.12 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 98.06 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 98.03 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 98.01 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.97 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 97.96 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 97.93 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.91 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.91 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.91 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 97.89 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.89 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 97.87 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 97.84 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.83 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.74 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.72 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.65 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 97.6 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.58 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 97.57 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.56 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 97.52 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.46 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.38 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 97.35 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 97.32 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 97.28 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.27 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.24 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.16 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 97.08 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 96.98 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 96.98 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.97 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.81 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 96.68 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 96.51 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.28 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 96.27 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.23 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 96.21 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 96.11 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 95.66 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 95.58 | |
| 3tbd_A | 338 | Netrin-G2, laminet-2; laminin N-terminal domain, d | 95.48 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 95.34 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 95.16 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 94.9 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 94.51 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 94.19 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 94.07 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 93.91 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 93.72 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 93.62 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 93.62 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 93.61 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 93.6 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 93.33 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 92.37 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 91.69 | |
| 2kl7_A | 71 | Fibulin-4; secreted, calcium, disease mutation, di | 91.59 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 91.14 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 90.86 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 89.64 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 88.45 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 88.16 | |
| 3asi_A | 410 | Neurexin-1-alpha; beta-sandwich, cell adhesion, sy | 87.04 | |
| 3qcw_A | 1245 | Neurexin-1-alpha; synaptic adhesion molecule, cell | 86.49 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 85.95 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 85.58 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 84.86 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 82.12 | |
| 1szb_A | 170 | Mannose binding lectin-associated serine protease- | 82.01 | |
| 1g1t_A | 157 | E-selectin; EGF, adhesion molecule, SLEX, immune s | 81.5 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 80.59 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 80.33 | |
| 3cfw_A | 164 | L-selectin; EGF, cell adhesion, EGF-like domain, g | 80.13 |
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
Probab=99.86 E-value=1.3e-22 Score=147.10 Aligned_cols=124 Identities=27% Similarity=0.686 Sum_probs=100.5
Q ss_pred cee-ecCCCCCCCCCccCCCCcccCCCCC--CCCCCcCCCCCCCC------CceecCCcccccCCCceeEe-ecCCCCCC
Q psy15473 3 RRC-ICQDNTGGDNCERCARGYYGNALEG--AVTDCKQCPCPNQG------PCVQLDDDQVSNLGNRTRIR-IKSALGGN 72 (190)
Q Consensus 3 ~~C-~C~~g~~G~~C~~C~~g~~g~~c~~--~~~~C~~~~C~~~g------~C~~~~~~~~~~~~~~~~c~-c~~~~~g~ 72 (190)
++| .|++||+|++||+|++||||..+.. ..+.|++++|++++ +|... ...|. |+++|.|.
T Consensus 18 ~~C~~C~~g~~G~~Ce~C~~g~~g~~~~~~~~~~~C~~C~C~~~~~~~~~~~C~~~----------tG~C~~C~~g~~G~ 87 (162)
T 1klo_A 18 VVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAVGNCNRL----------TGECLKCIYNTAGF 87 (162)
T ss_dssp EEECSCCTTEESTTSCEECTTEEEETTCTTSSCEEEEECCSTTCBCTTCSCCBCTT----------TCCBCCBCTTEETT
T ss_pred EEeCCCCCCCcCCCCcCCCCCCcCCcccccCCCCCCeeCcCCCCCCcccCCcccCC----------CCcccCCCCCCcCC
Confidence 579 7999999999999999999987763 34579999999874 33221 14674 88888887
Q ss_pred CCCCccccCCCccCCCCcccCCCCCCCCCCcccCCCcCCC-----CCccCCCCeeeCCCCCCCCCCccCCCCcccCCC
Q psy15473 73 RTRGLALTRQTHYQLTGYHHEPTSGGAFSRCVPCNCNGHA-----DICDAESGRCICQDNTGGDNCERCARGYYGNAL 145 (190)
Q Consensus 73 ~c~~~~~~~~~~~C~~G~~g~~~~~~~~~~C~~c~C~~~~-----~~C~~~~g~C~C~~g~~G~~C~~C~~G~~g~~c 145 (190)
+| +.|++||||..+.......|+++.|+..+ ..|++++|+|+|+++|+|.+|++|++||||...
T Consensus 88 ~C---------e~C~~Gy~g~~~~~~~~~~C~~C~C~~~Gs~~~~~~Cd~~tG~C~C~~g~~G~~Cd~C~~g~~g~~~ 156 (162)
T 1klo_A 88 YC---------DRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQS 156 (162)
T ss_dssp TT---------CEECTTEEECTTCSSGGGSEEECCCCTTTBGGGCCCCCTTTCCCCBCTTEESTTCCEECTTCBCGGG
T ss_pred Cc---------CcCchhhcCCccccCCCCCCeeccCCCCCccCCCCCCCCCCCEeECCCCCcCCCCCCCCCCcccCCC
Confidence 76 56999999988753234579999998764 279999999999999999999999999999764
|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >3asi_A Neurexin-1-alpha; beta-sandwich, cell adhesion, synapse maturation, neuroligin glycosylation, membrane; HET: NAG; 2.30A {Bos taurus} | Back alignment and structure |
|---|
| >3qcw_A Neurexin-1-alpha; synaptic adhesion molecule, cell adhesion; HET: NAG; 2.65A {Bos taurus} PDB: 3r05_A* 3poy_A* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 | Back alignment and structure |
|---|
| >1g1t_A E-selectin; EGF, adhesion molecule, SLEX, immune system, membrane protein; HET: SIA GAL MAG FUC; 1.50A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1esl_A | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3cfw_A L-selectin; EGF, cell adhesion, EGF-like domain, glycoprotein, membrane, sushi, transmembrane; HET: NAG MAN BMA; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 190 | ||||
| d1kloa2 | 56 | g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M | 3e-06 | |
| d1kloa3 | 51 | g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( | 2e-05 | |
| d1kloa1 | 55 | g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu | 0.001 |
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: Laminin-type module domain: Laminin gamma1 chain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 40.7 bits (95), Expect = 3e-06
Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 8/56 (14%)
Query: 106 CNCNGHADI-----CDAESGRCI-CQDNTGGDNCERCARGYYGNALEGAVTDCKQC 155
C CN + D C+ +G C+ C NT G C+RC G++GN L +C
Sbjct: 1 CQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAP--NPADKC 54
|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 190 | |||
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.85 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.84 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.82 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.75 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.73 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.65 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.59 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.55 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 98.53 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 98.5 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 98.48 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 98.43 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.39 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 98.38 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.38 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 98.33 | |
| d1kloa2 | 56 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.31 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.3 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 98.24 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 98.22 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 98.03 | |
| d1kloa3 | 51 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 98.0 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.97 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 97.93 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.91 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 97.89 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 97.83 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 97.79 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 97.77 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 97.74 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 97.73 | |
| d1kloa1 | 55 | Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: | 97.63 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 97.56 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 97.36 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 97.25 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 97.1 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.0 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 96.93 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 96.76 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 96.75 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 96.73 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 96.38 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.59 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 95.57 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.37 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 95.23 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 94.41 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 94.28 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 94.27 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 94.01 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 93.69 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.52 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 93.4 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 92.83 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.79 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 91.87 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 91.84 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 91.82 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.69 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 89.2 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 89.13 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 88.5 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 87.96 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 87.7 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 82.71 |
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.85 E-value=8.1e-10 Score=58.65 Aligned_cols=37 Identities=30% Similarity=0.735 Sum_probs=33.1
Q ss_pred CCCCcCCCCCCCCCceecCCCCeeeCCCCCCCCCCCCCC
Q psy15473 149 VTDCKQCPCPNQGPCVQLDDDQVVCSECPRGYGGEKMSP 187 (190)
Q Consensus 149 ~~~C~~~~C~~~g~C~~~~~~~~~C~~C~~G~~G~~C~~ 187 (190)
+++|.+.||.++|+|++.. +.|+| .|++||+|++||.
T Consensus 1 Id~C~~~PC~n~g~C~~~~-~~y~C-~C~~G~~G~~Ce~ 37 (39)
T d2vj3a2 1 VNECVSNPCQNDATCLDQI-GEFQC-ICMPGYEGVHCEV 37 (39)
T ss_dssp CCTTTTCCCCSSCEEEECS-SCEEE-ECCTTEESSSSCE
T ss_pred CcCCcCCCCCCCCEEECCC-CCEEE-eCCCCCccCcCee
Confidence 4679999999999999876 56999 9999999999985
|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|