Diaphorina citri psyllid: psy15475


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSSDDVR
ccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
*SLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSS****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSSDDVR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Laminin subunit gamma-1 Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.confidentP11047
Laminin-like protein lam-2 confidentQ18823
Laminin subunit gamma-1 Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.confidentQ1LVF0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043208 [MF]glycosphingolipid bindingprobableGO:0005488, GO:0003674, GO:0046625, GO:0008289, GO:0051861
GO:0031224 [CC]intrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005610 [CC]laminin-5 complexprobableGO:0043234, GO:0005605, GO:0005604, GO:0032991, GO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0043256, GO:0044420, GO:0044421
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789
GO:0070062 [CC]extracellular vesicular exosomeprobableGO:0043230, GO:0031982, GO:0044421, GO:0065010, GO:0031988, GO:0005575, GO:0005576, GO:0043227, GO:0043226
GO:0040011 [BP]locomotionprobableGO:0008150
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0034446 [BP]substrate adhesion-dependent cell spreadingprobableGO:0032502, GO:0031589, GO:0000904, GO:0000902, GO:0009653, GO:0048869, GO:0030154, GO:0048468, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0007155, GO:0008150, GO:0009987, GO:0022610, GO:0044699, GO:0048856
GO:0007166 [BP]cell surface receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0031346 [BP]positive regulation of cell projection organizationprobableGO:0051130, GO:0051128, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0031344, GO:0048522
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0051234 [BP]establishment of localizationprobableGO:0008150, GO:0051179
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0007409 [BP]axonogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0008150
GO:0001891 [CC]phagocytic cupprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0097458 [CC]neuron partprobableGO:0005575, GO:0044464, GO:0005623
GO:0001932 [BP]regulation of protein phosphorylationprobableGO:0042325, GO:0032268, GO:0019220, GO:0080090, GO:0019222, GO:0060255, GO:0031323, GO:0051246, GO:0050794, GO:0051174, GO:0065007, GO:0031399, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AQS, chain A
Confidence level:very confident
Coverage over the Query: 30-201
View the alignment between query and template
View the model in PyMOL
Template: 4AQT, chain A
Confidence level:very confident
Coverage over the Query: 5-123
View the alignment between query and template
View the model in PyMOL