Psyllid ID: psy15475

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSSDDVR
ccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccc
ccccHEEEEcccccccccccccccccccccccEEEEccccccccccHHccccccccccccccccccccccccccccccccccccccccccEEEccccccccccHcccccccccccccccccccccccccccccccccccEEEccccccccccHccccccccccccccccccccccccccccccccccccccccccccccccccc
MSLDVHHVSVMDILlcvgppsdilksvagttgDCLKciyntggpqcdtclpgyfgdalalpkgdcepcqcyipgtletetftpvcdqltgqcsckphvvgtncdqcevghyniisgegckscdcdpvgslnrtcdpitgqclcrpgvtgtrcelcqpnhygfsldgckpcmcdpigsnslqcdpsgqcpgvfmnraemssddvr
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNraemssddvr
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSSDDVR
****VHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQ***********************
*SLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSSD*V*
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRA********
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSS*D**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLDVHHVSVMDILLCVGPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCPGVFMNRAEMSSDDVR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
P15215 1639 Laminin subunit gamma-1 O yes N/A 0.725 0.090 0.593 1e-51
Q18823 1633 Laminin-like protein lam- yes N/A 0.774 0.096 0.552 8e-44
Q1LVF0 1593 Laminin subunit gamma-1 O yes N/A 0.808 0.103 0.517 2e-43
A0JP86 1592 Laminin subunit gamma-1 O yes N/A 0.759 0.097 0.522 2e-40
P11047 1609 Laminin subunit gamma-1 O yes N/A 0.759 0.096 0.522 6e-40
P02468 1607 Laminin subunit gamma-1 O yes N/A 0.759 0.096 0.515 2e-38
Q9R0B6 1581 Laminin subunit gamma-3 O no N/A 0.754 0.097 0.471 9e-36
Q9Y6N6 1575 Laminin subunit gamma-3 O no N/A 0.759 0.098 0.459 2e-35
P11046 1788 Laminin subunit beta-1 OS no N/A 0.720 0.082 0.477 3e-35
Q00174 3712 Laminin subunit alpha OS= no N/A 0.759 0.041 0.414 6e-28
>sp|P15215|LAMC1_DROME Laminin subunit gamma-1 OS=Drosophila melanogaster GN=LanB2 PE=2 SV=2 Back     alignment and function desciption
 Score =  202 bits (514), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 115/160 (71%)

Query: 30   TTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLT 89
            TTG+CLKCI+NT G  CD CL G+FGD LALP G C+ C CY  GT + E     CDQ+T
Sbjct: 864  TTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVT 923

Query: 90   GQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTG 149
            GQC CKP+V+G +C +C+ G++NI SG GC++C CDPVGS N TCD  +GQC CRPGV G
Sbjct: 924  GQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMG 983

Query: 150  TRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCP 189
             RC+ C+   YGFS +GCKPC CD  GS   QCD +GQCP
Sbjct: 984  QRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNGQCP 1023
Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components.
Drosophila melanogaster (taxid: 7227)
>sp|Q18823|LAM2_CAEEL Laminin-like protein lam-2 OS=Caenorhabditis elegans GN=lam-2 PE=1 SV=3 Back     alignment and function description
>sp|Q1LVF0|LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio GN=lamc1 PE=2 SV=2 Back     alignment and function description
>sp|A0JP86|LAMC1_XENTR Laminin subunit gamma-1 OS=Xenopus tropicalis GN=lamc1 PE=2 SV=1 Back     alignment and function description
>sp|P11047|LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens GN=LAMC1 PE=1 SV=3 Back     alignment and function description
>sp|P02468|LAMC1_MOUSE Laminin subunit gamma-1 OS=Mus musculus GN=Lamc1 PE=1 SV=2 Back     alignment and function description
>sp|Q9R0B6|LAMC3_MOUSE Laminin subunit gamma-3 OS=Mus musculus GN=Lamc3 PE=2 SV=2 Back     alignment and function description
>sp|Q9Y6N6|LAMC3_HUMAN Laminin subunit gamma-3 OS=Homo sapiens GN=LAMC3 PE=1 SV=3 Back     alignment and function description
>sp|P11046|LAMB1_DROME Laminin subunit beta-1 OS=Drosophila melanogaster GN=LanB1 PE=1 SV=4 Back     alignment and function description
>sp|Q00174|LAMA_DROME Laminin subunit alpha OS=Drosophila melanogaster GN=LanA PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
328717117 1319 PREDICTED: laminin subunit gamma-1-like 0.691 0.106 0.737 2e-65
328717115 1631 PREDICTED: laminin subunit gamma-1-like 0.647 0.080 0.737 3e-65
242020772 1616 laminin A chain, putative [Pediculus hum 0.705 0.089 0.706 2e-64
270004765 1635 hypothetical protein TcasGA2_TC010540 [T 0.779 0.097 0.65 2e-57
91092436 1615 PREDICTED: similar to laminin gamma 1 ch 0.779 0.098 0.65 2e-57
321466184 1626 hypothetical protein DAPPUDRAFT_321711 [ 0.779 0.097 0.65 1e-55
78183055 682 putative Laminin B2 [Drosophila yakuba] 0.774 0.231 0.588 1e-53
307203704 1646 Laminin subunit gamma-1 [Harpegnathos sa 0.779 0.096 0.652 9e-53
332017935 1497 Laminin subunit gamma-1 [Acromyrmex echi 0.779 0.106 0.645 2e-52
383858273 1652 PREDICTED: LOW QUALITY PROTEIN: laminin 0.779 0.096 0.633 6e-52
>gi|328717117|ref|XP_003246126.1| PREDICTED: laminin subunit gamma-1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  254 bits (648), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 118/160 (73%), Positives = 132/160 (82%)

Query: 30  TTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLT 89
           TTGDCLKCIYNTGGPQCD CLPGYFGDALA  KGDC+PC C+  GT ET      CDQLT
Sbjct: 541 TTGDCLKCIYNTGGPQCDQCLPGYFGDALAPEKGDCKPCDCFHLGTTETGFGPLACDQLT 600

Query: 90  GQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTG 149
           GQC CKPHV G NCDQCEVGH+NI SGEGC+SCDCDPVGS+N TCD  TGQC+CRPG+TG
Sbjct: 601 GQCQCKPHVTGVNCDQCEVGHFNIASGEGCQSCDCDPVGSVNNTCDTNTGQCICRPGITG 660

Query: 150 TRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCP 189
            +C+ C+P HYGFS++GCK C CD IG+ SLQCD +GQCP
Sbjct: 661 KKCDACEPYHYGFSIEGCKSCACDTIGAVSLQCDANGQCP 700

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328717115|ref|XP_001944333.2| PREDICTED: laminin subunit gamma-1-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242020772|ref|XP_002430825.1| laminin A chain, putative [Pediculus humanus corporis] gi|212516028|gb|EEB18087.1| laminin A chain, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270004765|gb|EFA01213.1| hypothetical protein TcasGA2_TC010540 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91092436|ref|XP_968632.1| PREDICTED: similar to laminin gamma 1 chain [Tribolium castaneum] Back     alignment and taxonomy information
>gi|321466184|gb|EFX77181.1| hypothetical protein DAPPUDRAFT_321711 [Daphnia pulex] Back     alignment and taxonomy information
>gi|78183055|gb|ABB29523.1| putative Laminin B2 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|307203704|gb|EFN82670.1| Laminin subunit gamma-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332017935|gb|EGI58584.1| Laminin subunit gamma-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383858273|ref|XP_003704626.1| PREDICTED: LOW QUALITY PROTEIN: laminin subunit gamma-1-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
FB|FBgn0002528 1639 LanB2 "Laminin B2" [Drosophila 0.784 0.097 0.593 4e-55
ZFIN|ZDB-GENE-021226-3 1593 lamc1 "laminin, gamma 1" [Dani 0.828 0.106 0.505 2.8e-49
WB|WBGene00016913 1633 lam-2 [Caenorhabditis elegans 0.774 0.096 0.552 9.9e-49
UNIPROTKB|P11047 1609 LAMC1 "Laminin subunit gamma-1 0.828 0.105 0.488 4.5e-46
UNIPROTKB|F1NI05 1007 LAMC1 "Uncharacterized protein 0.759 0.153 0.528 7e-46
UNIPROTKB|F1NK49 1608 LAMC1 "Uncharacterized protein 0.759 0.096 0.528 1.9e-45
UNIPROTKB|F1S663 1606 LAMC1 "Uncharacterized protein 0.828 0.105 0.482 3.2e-45
UNIPROTKB|F1PHK9 1487 LAMC1 "Uncharacterized protein 0.828 0.113 0.488 3.5e-45
UNIPROTKB|F1MAA7 1607 Lamc1 "Protein Lamc1" [Rattus 0.828 0.105 0.488 6.6e-45
UNIPROTKB|F1MD77 1608 LAMC1 "Uncharacterized protein 0.828 0.105 0.482 6.6e-45
FB|FBgn0002528 LanB2 "Laminin B2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 582 (209.9 bits), Expect = 4.0e-55, P = 4.0e-55
 Identities = 95/160 (59%), Positives = 115/160 (71%)

Query:    30 TTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLT 89
             TTG+CLKCI+NT G  CD CL G+FGD LALP G C+ C CY  GT + E     CDQ+T
Sbjct:   864 TTGECLKCIHNTAGEHCDQCLSGHFGDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVT 923

Query:    90 GQCSCKPHVVGTNCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTG 149
             GQC CKP+V+G +C +C+ G++NI SG GC++C CDPVGS N TCD  +GQC CRPGV G
Sbjct:   924 GQCQCKPNVIGRDCGECQPGYFNIRSGNGCENCLCDPVGSYNSTCDRYSGQCHCRPGVMG 983

Query:   150 TRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQCDPSGQCP 189
              RC+ C+   YGFS +GCKPC CD  GS   QCD +GQCP
Sbjct:   984 QRCDQCENYFYGFSSEGCKPCECDESGSKGFQCDQNGQCP 1023
GO:0005604 "basement membrane" evidence=ISS;NAS;IDA
GO:0031012 "extracellular matrix" evidence=IDA
GO:0005605 "basal lamina" evidence=IDA
GO:0009887 "organ morphogenesis" evidence=NAS
GO:0009888 "tissue development" evidence=NAS
GO:0048598 "embryonic morphogenesis" evidence=NAS
ZFIN|ZDB-GENE-021226-3 lamc1 "laminin, gamma 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
WB|WBGene00016913 lam-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P11047 LAMC1 "Laminin subunit gamma-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI05 LAMC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NK49 LAMC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1S663 LAMC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHK9 LAMC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAA7 Lamc1 "Protein Lamc1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MD77 LAMC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P02468LAMC1_MOUSENo assigned EC number0.51570.75980.0964yesN/A
Q18823LAM2_CAEELNo assigned EC number0.55270.77450.0967yesN/A
Q1LVF0LAMC1_DANRENo assigned EC number0.51740.80880.1035yesN/A
P11047LAMC1_HUMANNo assigned EC number0.52200.75980.0963yesN/A
P15215LAMC1_DROMENo assigned EC number0.59370.72540.0902yesN/A
A0JP86LAMC1_XENTRNo assigned EC number0.52200.75980.0973yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 6e-13
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 7e-13
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 2e-12
cd0005550 cd00055, EGF_Lam, Laminin-type epidermal growth fa 3e-07
smart0018046 smart00180, EGF_Lam, Laminin-type epidermal growth 1e-06
pfam0005349 pfam00053, Laminin_EGF, Laminin EGF-like (Domains 2e-05
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information 
 Score = 60.4 bits (147), Expect = 6e-13
 Identities = 29/49 (59%), Positives = 36/49 (73%)

Query: 122 CDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPC 170
           CDC+P GSL+ TCDP TGQCLC+PGVTG  C+ C+P +YG   D  + C
Sbjct: 1   CDCNPHGSLSDTCDPETGQCLCKPGVTGRHCDRCKPGYYGLPSDPGQGC 49

This family is like pfam00008 but has 8 conserved cysteines instead of six. Length = 49
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|238012 cd00055, EGF_Lam, Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>gnl|CDD|214543 smart00180, EGF_Lam, Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>gnl|CDD|215680 pfam00053, Laminin_EGF, Laminin EGF-like (Domains III and V) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG0994|consensus 1758 99.91
KOG0994|consensus 1758 99.9
KOG3512|consensus 592 99.81
KOG1836|consensus 1705 99.81
KOG1836|consensus 1705 99.75
KOG3512|consensus 592 99.09
KOG4289|consensus 2531 99.09
KOG4289|consensus 2531 98.98
KOG1225|consensus 525 98.77
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 98.75
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.65
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 98.52
KOG1219|consensus 4289 98.48
KOG1219|consensus 4289 98.44
KOG1225|consensus 525 98.35
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 98.09
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 98.06
KOG1226|consensus 783 98.06
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 97.95
smart0005163 DSL delta serrate ligand. 97.5
KOG4260|consensus350 97.43
KOG1226|consensus 783 97.18
KOG3509|consensus964 97.02
KOG4260|consensus 350 96.85
smart0005163 DSL delta serrate ligand. 96.7
KOG1217|consensus 487 96.68
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 96.41
KOG1388|consensus217 96.4
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.87
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 95.55
KOG1218|consensus 316 95.17
KOG1388|consensus217 94.86
PF0000832 EGF: EGF-like domain This is a sub-family of the P 94.64
KOG1218|consensus316 94.59
KOG1217|consensus487 94.31
smart0017939 EGF_CA Calcium-binding EGF-like domain. 93.68
KOG1214|consensus 1289 92.93
KOG3509|consensus964 92.55
KOG1214|consensus 1289 92.41
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 92.24
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 91.97
PF0141463 DSL: Delta serrate ligand; InterPro: IPR001774 Lig 90.71
smart0017939 EGF_CA Calcium-binding EGF-like domain. 89.74
cd0005336 EGF Epidermal growth factor domain, found in epide 85.65
smart0018135 EGF Epidermal growth factor-like domain. 84.09
KOG0196|consensus 996 83.82
KOG0196|consensus 996 82.84
>KOG0994|consensus Back     alignment and domain information 
Probab=99.91  E-value=6.9e-25  Score=198.28  Aligned_cols=170  Identities=42%  Similarity=0.983  Sum_probs=153.2

Q ss_pred             CCCCCccCCCCccccCCCCcCCCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCCccCCCCCCCcccCCCceeecCCCCccC
Q psy15475         22 DILKSVAGTTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGDCEPCQCYIPGTLETETFTPVCDQLTGQCSCKPHVVGT  101 (204)
Q Consensus        22 ~~~~~C~~~~g~C~~C~~~~~G~~C~~C~~g~~g~~c~~~~~~C~~c~C~~~g~~~~~~~~~~C~~~~g~C~C~~g~~G~  101 (204)
                      +..+.|+..+|.|++|.++|+|++|+.|++||||++-.   ..|..|.|+..|+.....    |+..+|+|.|.++..|.
T Consensus       976 ~d~~aCD~~TG~CLkCL~hTeG~hCe~Ck~Gf~GdA~~---q~CqrC~Cn~LGTn~~~~----CDr~tGQCpClpNv~G~ 1048 (1758)
T KOG0994|consen  976 YDPGACDVATGACLKCLYHTEGDHCEHCKDGFYGDALR---QNCQRCVCNFLGTNSTCH----CDRFTGQCPCLPNVQGV 1048 (1758)
T ss_pred             cCCCccchhhchhhhhhhcccccchhhccccchhHHHH---hhhhhheccccccCCccc----cccccCcCCCCcccccc
Confidence            34456778899999999999999999999999998765   358888998888865533    88899999999999999


Q ss_pred             CCcccCCCccccCCCCCCccCCCCCCCCCCCcccCCCCeeecCCCCccCCCCCCCCCcccCCCCCCccccCCCCCCCCCC
Q psy15475        102 NCDQCEVGHYNIISGEGCKSCDCDPVGSLNRTCDPITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPIGSNSLQ  181 (204)
Q Consensus       102 ~C~~C~~G~~g~~~~~~C~~c~C~~~g~~~~~C~~~~g~C~C~~g~~G~~C~~C~~g~~g~~~~~c~~C~C~~~g~~~~~  181 (204)
                      +|++|++.+|...++..|.+|.|++.+.  .+|+.++|+|+|+|||.|+.|+.|..-|||.+...|.+|+|++.|+...+
T Consensus      1049 ~CDqCA~N~w~laSG~GCe~C~Cd~~~~--pqCN~ftGQCqCkpGfGGR~C~qCqel~WGdP~~~C~aCdCd~rG~~tpQ 1126 (1758)
T KOG0994|consen 1049 RCDQCAENHWNLASGEGCEPCNCDPIGG--PQCNEFTGQCQCKPGFGGRTCSQCQELYWGDPNEKCRACDCDPRGIETPQ 1126 (1758)
T ss_pred             cccccccchhccccCCCCCccCCCccCC--ccccccccceeccCCCCCcchhHHHHhhcCCCCCCceecCCCCCCCCCCC
Confidence            9999999999988899999999999654  48999999999999999999999999999999999999999999999999


Q ss_pred             CC-CCCcccCCCCCCcccCC
Q psy15475        182 CD-PSGQCPGVFMNRAEMSS  200 (204)
Q Consensus       182 C~-~~g~C~c~~~~~g~~~~  200 (204)
                      |+ .+|+|.|.+|-.|..|-
T Consensus      1127 Cdr~tG~C~C~~Gv~G~rCd 1146 (1758)
T KOG0994|consen 1127 CDRATGRCVCRPGVGGPRCD 1146 (1758)
T ss_pred             ccccCCceeecCCCCCcchh
Confidence            99 89999999998887664

>KOG0994|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
4aqs_A525 Laminin Beta1 Ln-Le1-4 Structure Length = 525 2e-21
1klo_A162 Crystal Structure Of Three Consecutive Laminin-Type 2e-16
1npe_B164 Crystal Structure Of Nidogen/laminin Complex Length 2e-16
1tle_A58 Le (Laminin-Type Egf-Like) Module Giii4 In Solution 1e-04
>pdb|4AQS|A Chain A, Laminin Beta1 Ln-Le1-4 Structure Length = 525 Back     alignment and structure 
Iteration: 1

 Score = 59.7 bits (143), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 81/195 (41%), Gaps = 29/195 (14%)
Query: 18  GPPSDILKSVAGTTGDCLKCIYNTGGPQCDTCLPGY----FGDALALPKGDCEPCQCYIP 73
            P   + + V G       C +NT G  C+ C+  Y    +  A       C+ C C   
Sbjct: 264 APVDGVNEEVEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKKCNCNEH 323
Query: 74  GT---LETETFTPVCDQLTGQC-SCKPHVVGTNCDQCEVGHY-----NIISGEGCKSCDC 124
            +    +   F    +   G C +C+ + +G NC+QC+  ++     +I     C+ C C
Sbjct: 324 SSSCHFDMAVFLATGNVSGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTC 383
Query: 125 DPVGSLNR-TCD--------PITGQCLCRPGVTGTRCELCQPNHYGFSLDGCKPCMCDPI 175
           DP GS N   CD         I GQC C+  V G RC++C+   Y  S +       DP 
Sbjct: 384 DPAGSENGGICDGYTDFSVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAE-------DPY 436
Query: 176 GSNSLQCDPSGQCPG 190
           G  S  C+P G  PG
Sbjct: 437 GCKSCACNPLGTIPG 451
>pdb|1KLO|A Chain A, Crystal Structure Of Three Consecutive Laminin-Type Epidermal Growth Factor-Like (Le) Modules Of Laminin Gamma1 Chain Harboring The Nidogen Binding Site Length = 162 Back     alignment and structure
>pdb|1NPE|B Chain B, Crystal Structure Of Nidogen/laminin Complex Length = 164 Back     alignment and structure
>pdb|1TLE|A Chain A, Le (Laminin-Type Egf-Like) Module Giii4 In Solution At Ph 3.5 And 290 K, Nmr, 14 Structures Length = 58 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 7e-32
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 5e-26
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-19
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-10
4aqs_A 525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 2e-06
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-26
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-21
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 3e-14
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 7e-15
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 6e-07
1skz_A119 Antistasin; factor XA inhibitor, serine protease i 2e-04
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-13
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 3e-11
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 1e-05
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 2e-04
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 2e-10
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 1e-07
2y38_A403 Laminin subunit alpha-5; structural protein, cell 1e-09
2y38_A403 Laminin subunit alpha-5; structural protein, cell 3e-05
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 3e-08
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 1e-05
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 2e-05
3fcs_B 690 Integrin beta-3; beta propeller, rossmann fold, EG 7e-05
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 5e-04
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 9e-05
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 7e-04
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
 Score =  119 bits (300), Expect = 7e-32
 Identities = 68/173 (39%), Positives = 88/173 (50%), Gaps = 13/173 (7%)

Query: 30  TTGDCLKCIYNTGGPQCDTCLPGYFGDALALPKGD--CEPCQCYIPGTL----ETETFTP 83
           + G C  C +NT G  C+ C P YF       +    CEPC C   G+            
Sbjct: 341 SGGVCDNCQHNTMGRNCEQCKPFYFQHPERDIRDPNLCEPCTCDPAGSENGGICDGYTDF 400

Query: 84  VCDQLTGQCSCKPHVVGTNCDQCEVGHYNIIS--GEGCKSCDCDPVGSLNR--TCDPITG 139
               + GQC CK HV G  CD C+ G Y++ +    GCKSC C+P+G++     CD  TG
Sbjct: 401 SVGLIAGQCRCKLHVEGERCDVCKEGFYDLSAEDPYGCKSCACNPLGTIPGGNPCDSETG 460

Query: 140 QCLCRPGVTGTRCELCQPNHYGFS--LDGCKPCMCDPIGSNSLQCDP-SGQCP 189
            C C+  VTG RC+ C P H+G S  LDGC+PC CD  G+ +  C   SGQC 
Sbjct: 461 YCYCKRLVTGQRCDQCLPQHWGLSNDLDGCRPCDCDLGGALNNSCSEDSGQCS 513
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>1skz_A Antistasin; factor XA inhibitor, serine protease inhibitor, thrombosis; 1.90A {Haementeria officinalis} SCOP: g.3.15.1 g.3.15.1 Length = 119 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Length = 423 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 3ije_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Length = 690 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.92
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.85
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.82
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.72
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 99.69
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.68
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.43
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 99.37
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.28
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 99.24
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.22
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.21
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.17
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.14
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 99.07
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.05
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 99.05
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.04
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.03
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.87
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.86
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.85
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.82
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.76
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.44
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.28
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.27
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 98.25
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 98.21
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.2
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.13
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.05
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 97.97
2bou_A143 EGF-like module containing mucin-like hormone rece 97.9
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.82
2bou_A143 EGF-like module containing mucin-like hormone rece 97.78
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.75
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 97.68
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.49
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.4
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 97.36
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.3
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.17
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.08
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.96
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.94
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.87
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.86
2vh0_B134 Activated factor XA light chain; serine protease, 96.83
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 96.65
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.55
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 96.46
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 96.45
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 96.44
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.43
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 96.42
2vh0_B134 Activated factor XA light chain; serine protease, 96.38
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 96.31
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 96.26
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 96.07
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.05
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 95.99
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 95.99
1a3p_A45 Epidermal growth factor; disulfide connectivities, 95.85
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 95.83
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 95.77
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 95.76
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 95.73
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 95.67
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 95.35
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 95.34
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 95.18
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 95.05
1a3p_A45 Epidermal growth factor; disulfide connectivities, 94.85
2k2s_B61 Micronemal protein 6; microneme protein complex, c 94.69
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 94.57
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 93.22
1nql_B53 Epidermal growth factor; cell surface receptor, ty 93.18
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 93.03
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 92.94
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 92.46
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 92.14
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 91.42
2k2s_B61 Micronemal protein 6; microneme protein complex, c 91.38
3fl7_A 536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 91.21
1nql_B53 Epidermal growth factor; cell surface receptor, ty 90.69
3v65_B 386 Low-density lipoprotein receptor-related protein; 89.84
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 89.48
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 88.6
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 88.29
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 87.44
1q4g_A 553 Prostaglandin G/H synthase 1; cyclooxygenase, non- 87.13
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 86.68
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 85.98
3nt1_A 587 Prostaglandin-endoperoxide synthase 2; prostagland 84.69
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 84.23
3v65_B 386 Low-density lipoprotein receptor-related protein; 83.55
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 83.3
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 82.85
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 82.25
2p26_A280 Integrin beta-2; hybrid domain, PSI domain, I-EGF 81.87
2hey_R146 Tumor necrosis factor receptor superfamily member; 80.92
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
Probab=99.92  E-value=3.5e-26  Score=172.56  Aligned_cols=146  Identities=37%  Similarity=0.860  Sum_probs=117.6

Q ss_pred             CCCCCCCccCCC----CccccCCCCcCCCCCCCCCCCCCCCCCCC--CCCCCcCCCCCCCCccCCCCCCCcccCCCceee
Q psy15475         20 PSDILKSVAGTT----GDCLKCIYNTGGPQCDTCLPGYFGDALAL--PKGDCEPCQCYIPGTLETETFTPVCDQLTGQCS   93 (204)
Q Consensus        20 ~~~~~~~C~~~~----g~C~~C~~~~~G~~C~~C~~g~~g~~c~~--~~~~C~~c~C~~~g~~~~~~~~~~C~~~~g~C~   93 (204)
                      |+.++++|+..+    ++|+.|+++|+|.+|++|++||||.++..  ....|++++|++++..... +.  |+..+++|+
T Consensus         2 ~C~~~g~C~~~~~~g~~~C~~C~~g~~G~~Ce~C~~g~~g~~~~~~~~~~~C~~C~C~~~~~~~~~-~~--C~~~tG~C~   78 (162)
T 1klo_A            2 PCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVRLCRPCQCNDNIDPNAV-GN--CNRLTGECL   78 (162)
T ss_dssp             CSCTTCCEEECSSSCCEEECSCCTTEESTTSCEECTTEEEETTCTTSSCEEEEECCSTTCBCTTCS-CC--BCTTTCCBC
T ss_pred             cCcCcCcccccCCCCCEEeCCCCCCCcCCCCcCCCCCCcCCcccccCCCCCCeeCcCCCCCCcccC-Cc--ccCCCCccc
Confidence            466788997765    47956999999999999999999987752  2246889999877532111 02  888899995


Q ss_pred             -cCCCCccCCCcccCCCccccCCC----CCCccCCCCCCCCCC--CcccCCCCeeecCCCCccCCCCCCCCCcccCCC-C
Q psy15475         94 -CKPHVVGTNCDQCEVGHYNIISG----EGCKSCDCDPVGSLN--RTCDPITGQCLCRPGVTGTRCELCQPNHYGFSL-D  165 (204)
Q Consensus        94 -C~~g~~G~~C~~C~~G~~g~~~~----~~C~~c~C~~~g~~~--~~C~~~~g~C~C~~g~~G~~C~~C~~g~~g~~~-~  165 (204)
                       |+++|+|.+|++|++||||....    ..|++|.|++.++..  ++|+..+|+|.|+++|+|++|++|++|||+++. .
T Consensus        79 ~C~~g~~G~~Ce~C~~Gy~g~~~~~~~~~~C~~C~C~~~Gs~~~~~~Cd~~tG~C~C~~g~~G~~Cd~C~~g~~g~~~~~  158 (162)
T 1klo_A           79 KCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQ  158 (162)
T ss_dssp             CBCTTEETTTTCEECTTEEECTTCSSGGGSEEECCCCTTTBGGGCCCCCTTTCCCCBCTTEESTTCCEECTTCBCGGGSS
T ss_pred             CCCCCCcCCCcCcCchhhcCCccccCCCCCCeeccCCCCCccCCCCCCCCCCCEeECCCCCcCCCCCCCCCCcccCCCCC
Confidence             99999999999999999986433    568899999877643  389998999999999999999999999999864 4


Q ss_pred             CCc
Q psy15475        166 GCK  168 (204)
Q Consensus       166 ~c~  168 (204)
                      +|+
T Consensus       159 GC~  161 (162)
T 1klo_A          159 GCE  161 (162)
T ss_dssp             CCB
T ss_pred             CcC
Confidence            454
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* Back     alignment and structure
>2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 204
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 2e-08
d1kloa351 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse ( 9e-08
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 4e-06
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 1e-04
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 7e-04
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 46.8 bits (111), Expect = 2e-08
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 3/50 (6%)

Query: 122 CDCDPVGSLNR--TCDPITGQCLCRPGVTGTRCELCQPNHYGF-SLDGCK 168
           C C+P G++ +  +C+P+TGQC C P V+G  C  C P +Y   S  GC+
Sbjct: 1   CACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQSGQGCE 50
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 51 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.72
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.43
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.43
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.29
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.85
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.7
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.63
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.62
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.62
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.55
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.53
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 97.21
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.19
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.17
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 97.14
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.98
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 96.97
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.96
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 96.93
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 96.88
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.85
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 96.67
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 96.37
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 96.21
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.17
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.13
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 96.11
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 95.81
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 95.39
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 95.1
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 94.67
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 94.58
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 94.28
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 94.1
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 93.9
d2i9aa140 Plasminogen activator (urokinase-type) {Human (Hom 93.85
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 92.92
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 92.78
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 91.91
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 91.65
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 91.52
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 86.14
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 85.27
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 85.15
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 85.06
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 82.81
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=98.72  E-value=1.9e-09  Score=63.45  Aligned_cols=42  Identities=43%  Similarity=1.220  Sum_probs=35.0

Q ss_pred             CCCCCCCCC--CCcccCCCCeeecCCCCccCCCCCCCCCcccCC
Q psy15475        122 CDCDPVGSL--NRTCDPITGQCLCRPGVTGTRCELCQPNHYGFS  163 (204)
Q Consensus       122 c~C~~~g~~--~~~C~~~~g~C~C~~g~~G~~C~~C~~g~~g~~  163 (204)
                      |.|++.++.  ...|+..+|+|.|+++++|++|++|.+|||+++
T Consensus         1 C~C~~~Gs~~~~~~Cd~~tGqC~Ck~~v~G~~Cd~C~~g~~~~~   44 (51)
T d1kloa3           1 CACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGYYNLQ   44 (51)
T ss_dssp             CCCCTTTBGGGCCCCCTTTCCCCBCTTEESTTCCEECTTCBCGG
T ss_pred             CcCCCCcccCCCCccCCCCCeecCCCCCcCCCcccccccccCCC
Confidence            456666653  346888899999999999999999999999974
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure