Diaphorina citri psyllid: psy1547

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MSAKIPNVSQLSSRVIRVLGMNPGPMTLQGTNTYILGTGSRRLLLDTGEPDHMEYIENLKQVLNKESISLEHIVLSHWHNDHVGGLKDIFEHINPDSATIWKFKGTEKDEAQATDFVPENKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEEENVVFSGDTILGEGTTVFSDLISYIESLRRIRSLKPDIIYPAHGPVVEVGLSFSLMPT
ccccccccccccccEEEEcccccccccccccCEEEEECccEEEEECccccccHHHHHHHHHHHHHccccccEEEEccccccccHHHHHHHHHccccccccccccccccccHHcccccccccccEEcccccEEEEccEEEEEEcccccccccEEEEEccccEEEEccccccccccccccHHHHHHHHHHHHcccccEECccccccccccHHHccccc
***KIPNVSQLSSRVIRVLGMNPGPMTLQGTNTYILGTGSRRLLLDTGEPDHMEYIENLKQVLNKESISLEHIVLSHWHNDHVGGLKDIFEHINPDSATIWKFKGTEKDEAQATDFVPENKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEEENVVFSGDTILGEGTTVFSDLISYIESLRRIRSLKPDIIYPAHGPVVEVGLSFSLM**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAKIPNVSQLSSRVIRVLGMNPGPMTLQGTNTYILGTGSRRLLLDTGEPDHMEYIENLKQVLNKESISLEHIVLSHWHNDHVGGLKDIFEHINPDSATIWKFKGTEKDEAQATDFVPENKTVQTLTDGQLLKVEGATLRVIHTPGHTTDHIVLKLEEENVVFSGDTILGEGTTVFSDLISYIESLRRIRSLKPDIIYPAHGPVVEVGLSFSLMPT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Beta-lactamase-like protein 2 confidentQ1LZ83
Beta-lactamase-like protein 2 confidentQ99KR3
Beta-lactamase-like protein 2 confidentQ6NYF0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:1901360 [BP]organic cyclic compound metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0016787 [MF]hydrolase activityprobableGO:0003824, GO:0003674
GO:0019243 [BP]methylglyoxal catabolic process to D-lactateprobableGO:1901575, GO:0046185, GO:0006081, GO:0006082, GO:0009056, GO:0009987, GO:0006089, GO:0019752, GO:0032787, GO:0044248, GO:0071704, GO:0044710, GO:0051596, GO:0044237, GO:0008152, GO:0043436, GO:0008150, GO:0009438, GO:0044281, GO:1901615

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4AD9, chain A
Confidence level:very confident
Coverage over the Query: 1-207
View the alignment between query and template
View the model in PyMOL