Diaphorina citri psyllid: psy15495


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MYHLGTSSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTIDR
ccccccHHHHHHHHHHcccccccccccccccccEEEccccccccEEEcccccccccccccccEEEEcccccCEEEcccccccccccccccccccHHHHEEEccEEccccccHHHHHHHHEEEEEcccCEccccccccccccccccccccccccccccc
MYHLG**SLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTI**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYHLGTSSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTIDR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0001653 [MF]peptide receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0017046 [MF]peptide hormone bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0042562, GO:0005488
GO:0007186 [BP]G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0008036 [MF]diuretic hormone receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0031623 [BP]receptor internalizationprobableGO:0051234, GO:0006898, GO:0006897, GO:0016192, GO:0044260, GO:0006810, GO:0044237, GO:0043170, GO:0071704, GO:0044765, GO:0008150, GO:0008152, GO:0009987, GO:0043112, GO:0051179, GO:0044699
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0045762 [BP]positive regulation of adenylate cyclase activityprobableGO:0019220, GO:0031281, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0031323, GO:1900371, GO:0045981, GO:0043085, GO:0009893, GO:0030819, GO:0030816, GO:0045761, GO:0051349, GO:0009891, GO:0030810, GO:0050789, GO:0065007, GO:0044093, GO:0048518, GO:0065009, GO:0045935, GO:0045937, GO:0019219, GO:0050790, GO:0009889, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0051173, GO:0030799, GO:0031279, GO:1900544, GO:0030802, GO:1900542, GO:0030808, GO:0080090, GO:0030804, GO:0030801, GO:1900373, GO:0051339, GO:0030817, GO:0006140, GO:0030814, GO:0010562, GO:0048522
GO:0071310 [BP]cellular response to organic substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0007202 [BP]activation of phospholipase C activityprobableGO:0051336, GO:0060193, GO:0060191, GO:0019222, GO:0051345, GO:0050790, GO:0050789, GO:0010518, GO:1900274, GO:0065007, GO:0043085, GO:0044093, GO:0008150, GO:0010863, GO:0065009, GO:0010517
GO:0004930 [MF]G-protein coupled receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0009725 [BP]response to hormone stimulusprobableGO:0009719, GO:0042221, GO:0050896, GO:0008150, GO:0010033

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N7S, chain A
Confidence level:very confident
Coverage over the Query: 7-90
View the alignment between query and template
View the model in PyMOL
Template: 3N7S, chain A
Confidence level:very confident
Coverage over the Query: 65-93,106-146
View the alignment between query and template
View the model in PyMOL