Psyllid ID: psy15495
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| 328715789 | 466 | PREDICTED: calcitonin gene-related pepti | 0.481 | 0.163 | 0.605 | 1e-22 | |
| 321458499 | 377 | putative DH31 receptor [Daphnia pulex] | 0.462 | 0.193 | 0.602 | 5e-22 | |
| 118795187 | 427 | AGAP001175-PA [Anopheles gambiae str. PE | 0.474 | 0.175 | 0.6 | 2e-21 | |
| 345481443 | 411 | PREDICTED: calcitonin receptor-like isof | 0.449 | 0.172 | 0.619 | 4e-20 | |
| 345481445 | 492 | PREDICTED: calcitonin receptor-like isof | 0.449 | 0.144 | 0.619 | 5e-20 | |
| 157113539 | 544 | calcitonin receptor [Aedes aegypti] | 0.474 | 0.137 | 0.52 | 2e-19 | |
| 170052362 | 451 | calcitonin receptor [Culex quinquefascia | 0.449 | 0.157 | 0.549 | 2e-19 | |
| 403182794 | 422 | AAEL006490-PA, partial [Aedes aegypti] | 0.468 | 0.175 | 0.527 | 2e-19 | |
| 357612140 | 410 | neuropeptide receptor B4 [Danaus plexipp | 0.468 | 0.180 | 0.527 | 4e-19 | |
| 340721170 | 466 | PREDICTED: calcitonin receptor-like [Bom | 0.449 | 0.152 | 0.577 | 6e-19 |
| >gi|328715789|ref|XP_001945278.2| PREDICTED: calcitonin gene-related peptide type 1 receptor-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 111 bits (278), Expect = 1e-22, Method: Compositional matrix adjust.
Identities = 46/76 (60%), Positives = 60/76 (78%)
Query: 22 DSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRK 81
DS +CP FDGW+C N T AGE A+ PCP FI+GFD++RF +TCL +G+WF+HP + K
Sbjct: 39 DSDAWCPGEFDGWTCINRTKAGEVAKFPCPYFILGFDTKRFGQKTCLPDGSWFKHPDSNK 98
Query: 82 FWSNYTTCIDIEDLKV 97
WSNYTTC+D+EDLK+
Sbjct: 99 TWSNYTTCVDLEDLKL 114
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321458499|gb|EFX69566.1| putative DH31 receptor [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|118795187|ref|XP_321982.3| AGAP001175-PA [Anopheles gambiae str. PEST] gi|116116654|gb|EAA00956.4| AGAP001175-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|345481443|ref|XP_001601649.2| PREDICTED: calcitonin receptor-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345481445|ref|XP_003424370.1| PREDICTED: calcitonin receptor-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|157113539|ref|XP_001651988.1| calcitonin receptor [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|170052362|ref|XP_001862186.1| calcitonin receptor [Culex quinquefasciatus] gi|167873341|gb|EDS36724.1| calcitonin receptor [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|403182794|gb|EAT41922.2| AAEL006490-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|357612140|gb|EHJ67831.1| neuropeptide receptor B4 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|340721170|ref|XP_003398998.1| PREDICTED: calcitonin receptor-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 158 | ||||||
| FB|FBgn0030437 | 486 | hec "hector" [Drosophila melan | 0.588 | 0.191 | 0.430 | 6.1e-20 | |
| FB|FBgn0052843 | 443 | Dh31-R1 "Diuretic hormone 31 r | 0.443 | 0.158 | 0.528 | 1.6e-18 | |
| ZFIN|ZDB-GENE-060503-420 | 598 | calcr "calcitonin receptor" [D | 0.430 | 0.113 | 0.485 | 1.6e-14 | |
| MGI|MGI:101950 | 515 | Calcr "calcitonin receptor" [M | 0.411 | 0.126 | 0.476 | 4.2e-14 | |
| UNIPROTKB|F1SFC3 | 498 | CALCR "Calcitonin receptor" [S | 0.411 | 0.130 | 0.446 | 7.8e-13 | |
| UNIPROTKB|P25117 | 498 | CALCR "Calcitonin receptor" [S | 0.411 | 0.130 | 0.446 | 7.8e-13 | |
| UNIPROTKB|F1P5E1 | 469 | CALCR "Uncharacterized protein | 0.487 | 0.164 | 0.405 | 8.9e-13 | |
| UNIPROTKB|F1NH61 | 470 | CALCR "Uncharacterized protein | 0.487 | 0.163 | 0.405 | 8.9e-13 | |
| UNIPROTKB|G3X6P6 | 462 | CALCRL "Calcitonin gene-relate | 0.436 | 0.149 | 0.376 | 1.4e-12 | |
| UNIPROTKB|A6QP74 | 462 | CALCRL "Calcitonin gene-relate | 0.411 | 0.140 | 0.384 | 1.8e-12 |
| FB|FBgn0030437 hec "hector" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 243 (90.6 bits), Expect = 6.1e-20, P = 6.1e-20
Identities = 40/93 (43%), Positives = 60/93 (64%)
Query: 10 TTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLE 69
T ++ T ++ L+CP FDG+ CW T AG CP+F+ GF+ + A +TCLE
Sbjct: 103 TVVSATMATNQKENRLFCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLE 162
Query: 70 NGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLS 102
NG+W++HPV+ + WSNYT C+D EDL+ F++
Sbjct: 163 NGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFIN 195
|
|
| FB|FBgn0052843 Dh31-R1 "Diuretic hormone 31 receptor 1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-060503-420 calcr "calcitonin receptor" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:101950 Calcr "calcitonin receptor" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SFC3 CALCR "Calcitonin receptor" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P25117 CALCR "Calcitonin receptor" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P5E1 CALCR "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NH61 CALCR "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3X6P6 CALCRL "Calcitonin gene-related peptide type 1 receptor" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QP74 CALCRL "Calcitonin gene-related peptide type 1 receptor" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| pfam02793 | 63 | pfam02793, HRM, Hormone receptor domain | 8e-21 | |
| smart00008 | 70 | smart00008, HormR, Domain present in hormone recep | 3e-15 |
| >gnl|CDD|202399 pfam02793, HRM, Hormone receptor domain | Back alignment and domain information |
|---|
Score = 80.1 bits (198), Expect = 8e-21
Identities = 29/69 (42%), Positives = 34/69 (49%), Gaps = 6/69 (8%)
Query: 24 TLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFW 83
L CP +DG CW T AG T PCP++ FD A R C ENGTW +HP
Sbjct: 1 GLGCPRTWDGILCWPRTPAGTTVEVPCPDYFYDFDPTGNASRNCTENGTWSEHP------ 54
Query: 84 SNYTTCIDI 92
NY+ C
Sbjct: 55 PNYSNCTSN 63
|
This extracellular domain contains four conserved cysteines that probably for disulphide bridges. The domain is found in a variety of hormone receptors. It may be a ligand binding domain. Length = 63 |
| >gnl|CDD|214468 smart00008, HormR, Domain present in hormone receptors | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| KOG4564|consensus | 473 | 99.93 | ||
| smart00008 | 70 | HormR Domain present in hormone receptors. | 99.78 | |
| PF02793 | 66 | HRM: Hormone receptor domain; InterPro: IPR001879 | 99.75 | |
| KOG4564|consensus | 473 | 98.8 | ||
| smart00008 | 70 | HormR Domain present in hormone receptors. | 97.73 | |
| PF02793 | 66 | HRM: Hormone receptor domain; InterPro: IPR001879 | 97.58 | |
| PHA02831 | 268 | EEV host range protein; Provisional | 93.4 | |
| PHA02817 | 225 | EEV Host range protein; Provisional | 92.82 | |
| PHA02639 | 295 | EEV host range protein; Provisional | 90.23 | |
| KOG4289|consensus | 2531 | 90.21 | ||
| smart00032 | 57 | CCP Domain abundant in complement control proteins | 88.05 | |
| cd00033 | 57 | CCP Complement control protein (CCP) modules (aka | 87.78 | |
| PF00084 | 56 | Sushi: Sushi domain (SCR repeat); InterPro: IPR000 | 81.95 | |
| PHA02927 | 263 | secreted complement-binding protein; Provisional | 81.21 | |
| PHA02639 | 295 | EEV host range protein; Provisional | 81.06 |
| >KOG4564|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=4.6e-27 Score=205.23 Aligned_cols=117 Identities=29% Similarity=0.538 Sum_probs=99.0
Q ss_pred ccccccccCCCCCCCCCCCcccccccccCCCCCCCceEEecCCccccccc--cccceeeeeCCCCeEEecCCCCcccccc
Q psy15495 9 LTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFD--SRRFALRTCLENGTWFQHPVTRKFWSNY 86 (158)
Q Consensus 9 ~~~~~~~~~~~~~~~~~~C~~~wD~~~CWp~t~~G~~v~~~CP~~~~~~~--~~~~a~R~C~~dG~W~~~p~t~~~wtnY 86 (158)
.|.+.++.+++..+ +.+||++||+++|||+|++|++|.++||+||++|+ .+++|+|+|++||+|..+|.. ++|+||
T Consensus 47 ~c~~~l~~~~~~~~-~~~Cn~twD~~lCWp~t~~G~~v~~~CP~yf~~~~~~~~~~v~R~C~~~G~W~~~~~~-~~W~ny 124 (473)
T KOG4564|consen 47 QCLEELALEPPYSA-GLGCNGTWDGILCWPRTPAGTLVTVPCPDYFPGFSYSTSGNVTRNCTSNGTWSERPPS-RTWTNY 124 (473)
T ss_pred HHHHHHHhCCCccC-CCCCCCcCCccccCCCCCCCceEEecCccccCCCcccCCCceEeecCCCCccCCCCCc-CCCCCc
Confidence 45556666655533 78999999999999999999999999999999997 789999999999999999888 899999
Q ss_pred ccccCcchHH-----HHHhhhceecceeeeeeee-----------cceeEeeeCCCC
Q psy15495 87 TTCIDIEDLK-----VYLFLSCCFNGKKNGLIIN-----------LRFALRTCLENG 127 (158)
Q Consensus 87 t~C~~~~~~~-----~~~~~~~ly~gytvgys~~-----------~~~a~k~C~~nG 127 (158)
++|...++.+ ...++..++++|+|||+.+ ..|...+|.||-
T Consensus 125 t~C~~~~~~~~~~~~~~~~~~~~~~lytvGyslSl~sL~vAl~If~~FR~L~CtRn~ 181 (473)
T KOG4564|consen 125 TACGKNEEEEERQLDREYFLELLKILYTVGYSLSLVSLLVALIIFLYFRSLHCTRNY 181 (473)
T ss_pred hhccCcchhhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHH
Confidence 9999886543 3357777889999999888 246788898875
|
|
| >smart00008 HormR Domain present in hormone receptors | Back alignment and domain information |
|---|
| >PF02793 HRM: Hormone receptor domain; InterPro: IPR001879 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >KOG4564|consensus | Back alignment and domain information |
|---|
| >smart00008 HormR Domain present in hormone receptors | Back alignment and domain information |
|---|
| >PF02793 HRM: Hormone receptor domain; InterPro: IPR001879 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) | Back alignment and domain information |
|---|
| >PHA02831 EEV host range protein; Provisional | Back alignment and domain information |
|---|
| >PHA02817 EEV Host range protein; Provisional | Back alignment and domain information |
|---|
| >PHA02639 EEV host range protein; Provisional | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) | Back alignment and domain information |
|---|
| >cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system | Back alignment and domain information |
|---|
| >PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins | Back alignment and domain information |
|---|
| >PHA02927 secreted complement-binding protein; Provisional | Back alignment and domain information |
|---|
| >PHA02639 EEV host range protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 158 | ||||
| 3n7r_A | 115 | Crystal Structure Of The Ectodomain Complex Of The | 2e-12 | ||
| 3aqf_B | 121 | Crystal Structure Of The Human CrlrRAMP2 EXTRACELLU | 4e-12 | ||
| 3n7p_A | 115 | Crystal Structure Of The Ectodomain Complex Of The | 4e-12 | ||
| 3l2j_A | 535 | Dimeric Structure Of The Ligand-Free Extracellular | 1e-08 | ||
| 3c4m_A | 539 | Structure Of Human Parathyroid Hormone In Complex W | 1e-08 | ||
| 3n93_A | 482 | Crystal Structure Of Human Crfr2 Alpha Extracellula | 6e-07 | ||
| 2jnd_A | 119 | 3d Nmr Structure Of Ecd1 Of Mcrf-R2b In Complex Wit | 4e-05 | ||
| 1u34_A | 119 | 3d Nmr Structure Of The First Extracellular Domain | 4e-05 | ||
| 2jnc_A | 119 | Refined 3d Nmr Structure Of Ecd1 Of Mcrf-R2beta At | 8e-05 | ||
| 3ehu_A | 476 | Crystal Structure Of The Extracellular Domain Of Hu | 6e-04 | ||
| 3eht_A | 476 | Crystal Structure Of The Extracellular Domain Of Hu | 6e-04 | ||
| 3ehs_A | 476 | Crystal Structure Of The Extracellular Domain Of Hu | 6e-04 |
| >pdb|3N7R|A Chain A, Crystal Structure Of The Ectodomain Complex Of The Cgrp Receptor, A Class-B Gpcr, Reveals The Site Of Drug Antagonism Length = 115 | Back alignment and structure |
|
| >pdb|3AQF|B Chain B, Crystal Structure Of The Human CrlrRAMP2 EXTRACELLULAR COMPLEX Length = 121 | Back alignment and structure |
| >pdb|3N7P|A Chain A, Crystal Structure Of The Ectodomain Complex Of The Cgrp Receptor, A Class-B Gpcr, Reveals The Site Of Drug Antagonism Length = 115 | Back alignment and structure |
| >pdb|3L2J|A Chain A, Dimeric Structure Of The Ligand-Free Extracellular Domain Of Parathyroid Hormone Receptor (Pth1r) Length = 535 | Back alignment and structure |
| >pdb|3C4M|A Chain A, Structure Of Human Parathyroid Hormone In Complex With The Extracellular Domain Of Its G-Protein-Coupled Receptor (Pth1r) Length = 539 | Back alignment and structure |
| >pdb|3N93|A Chain A, Crystal Structure Of Human Crfr2 Alpha Extracellular Domain In Complex With Urocortin 3 Length = 482 | Back alignment and structure |
| >pdb|2JND|A Chain A, 3d Nmr Structure Of Ecd1 Of Mcrf-R2b In Complex With Astressin Length = 119 | Back alignment and structure |
| >pdb|1U34|A Chain A, 3d Nmr Structure Of The First Extracellular Domain Of Crfr- 2beta, A Type B1 G-Protein Coupled Receptor Length = 119 | Back alignment and structure |
| >pdb|3EHU|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (crfr1) In Complex With Crf Length = 476 | Back alignment and structure |
| >pdb|3EHT|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (crfr1) In Complex With Crf Length = 476 | Back alignment and structure |
| >pdb|3EHS|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (Crfr1) Length = 476 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 158 | |||
| 3n7s_A | 115 | Calcitonin gene-related peptide type 1 receptor; G | 2e-25 | |
| 3n7s_A | 115 | Calcitonin gene-related peptide type 1 receptor; G | 2e-06 | |
| 3c5t_A | 122 | Glucagon-like peptide 1 receptor; ligand-bound G p | 4e-24 | |
| 2qkh_A | 135 | Glucose-dependent insulinotropic polypeptide recep | 5e-21 | |
| 1u34_A | 119 | CRFR2B, corticotropin releasing factor receptor 2; | 1e-17 | |
| 2l27_A | 84 | Seven transmembrane helix receptor; CRF, ECD1, fam | 9e-17 | |
| 3h3g_A | 539 | Fusion protein of maltose-binding periplasmic DOM | 1e-15 | |
| 2xdg_A | 92 | Growth hormone-releasing hormone receptor; signali | 2e-15 | |
| 2x57_A | 116 | Vasoactive intestinal polypeptide receptor 2; G-pr | 3e-15 | |
| 2jod_A | 106 | Pituitary adenylate cyclase-activating polypeptide | 1e-11 | |
| 3n94_A | 475 | Fusion protein of maltose-binding periplasmic Pro | 5e-05 |
| >3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B Length = 115 | Back alignment and structure |
|---|
Score = 92.9 bits (230), Expect = 2e-25
Identities = 26/77 (33%), Positives = 39/77 (50%)
Query: 13 NFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGT 72
M + +YC +DGW CWN AG + CP++ FD + C ++G
Sbjct: 33 KIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGN 92
Query: 73 WFQHPVTRKFWSNYTTC 89
WF+HP + + W+NYT C
Sbjct: 93 WFRHPASNRTWTNYTQC 109
|
| >3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B Length = 115 | Back alignment and structure |
|---|
| >3c5t_A Glucagon-like peptide 1 receptor; ligand-bound G protein-coupled receptor extracellular domain protein coupled receptor, glycoprotein, membrane; HET: 10M; 2.10A {Homo sapiens} PDB: 3c59_A* 3iol_A* Length = 122 | Back alignment and structure |
|---|
| >2qkh_A Glucose-dependent insulinotropic polypeptide receptor; GPCR, incretin, hormone-GPCR complex, extracellular domain, ligand binding domain, ECD; HET: QKH; 1.90A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >1u34_A CRFR2B, corticotropin releasing factor receptor 2; beta sheets and loops, signaling protein; NMR {Mus musculus} SCOP: g.76.1.1 PDB: 2jnd_A* 2jnc_A Length = 119 | Back alignment and structure |
|---|
| >2l27_A Seven transmembrane helix receptor; CRF, ECD1, family B1, alpha helical CRF, membrane P peptide binding protein; NMR {Homo sapiens} Length = 84 | Back alignment and structure |
|---|
| >3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Length = 539 | Back alignment and structure |
|---|
| >2xdg_A Growth hormone-releasing hormone receptor; signaling protein, membrane protein; 1.95A {Homo sapiens} Length = 92 | Back alignment and structure |
|---|
| >2x57_A Vasoactive intestinal polypeptide receptor 2; G-protein coupled receptor, circadian rhythm, MALE reproduct hormone binding, growth, transducer; 2.10A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2jod_A Pituitary adenylate cyclase-activating polypeptide type I receptor; protein/peptide complex, signaling protein; NMR {Homo sapiens} SCOP: g.76.1.1 Length = 106 | Back alignment and structure |
|---|
| >3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Length = 475 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| 3n7s_A | 115 | Calcitonin gene-related peptide type 1 receptor; G | 99.94 | |
| 4ers_A | 96 | GL-R, glucagon receptor; class-B GPCR, FAB, glycos | 99.93 | |
| 3c5t_A | 122 | Glucagon-like peptide 1 receptor; ligand-bound G p | 99.92 | |
| 2qkh_A | 135 | Glucose-dependent insulinotropic polypeptide recep | 99.89 | |
| 2l27_A | 84 | Seven transmembrane helix receptor; CRF, ECD1, fam | 99.87 | |
| 2xdg_A | 92 | Growth hormone-releasing hormone receptor; signali | 99.86 | |
| 1u34_A | 119 | CRFR2B, corticotropin releasing factor receptor 2; | 99.85 | |
| 2x57_A | 116 | Vasoactive intestinal polypeptide receptor 2; G-pr | 99.84 | |
| 2jod_A | 106 | Pituitary adenylate cyclase-activating polypeptide | 99.84 | |
| 3h3g_A | 539 | Fusion protein of maltose-binding periplasmic DOM | 99.83 | |
| 3n94_A | 475 | Fusion protein of maltose-binding periplasmic Pro | 99.74 | |
| 3n7s_A | 115 | Calcitonin gene-related peptide type 1 receptor; G | 99.12 | |
| 4ers_A | 96 | GL-R, glucagon receptor; class-B GPCR, FAB, glycos | 99.05 | |
| 3c5t_A | 122 | Glucagon-like peptide 1 receptor; ligand-bound G p | 98.87 | |
| 3h3g_A | 539 | Fusion protein of maltose-binding periplasmic DOM | 98.71 | |
| 1u34_A | 119 | CRFR2B, corticotropin releasing factor receptor 2; | 98.26 | |
| 4dlq_A | 381 | Latrophilin-1; GAIN domain, includes the GPS motif | 98.14 | |
| 2qkh_A | 135 | Glucose-dependent insulinotropic polypeptide recep | 98.09 | |
| 2l27_A | 84 | Seven transmembrane helix receptor; CRF, ECD1, fam | 98.0 | |
| 2xdg_A | 92 | Growth hormone-releasing hormone receptor; signali | 97.34 | |
| 2x57_A | 116 | Vasoactive intestinal polypeptide receptor 2; G-pr | 97.19 | |
| 3n94_A | 475 | Fusion protein of maltose-binding periplasmic Pro | 97.07 | |
| 2jod_A | 106 | Pituitary adenylate cyclase-activating polypeptide | 96.88 | |
| 4dlo_A | 382 | Brain-specific angiogenesis inhibitor 3; GAIN doma | 96.65 | |
| 1bl1_A | 31 | Parathyroid hormone receptor; micelle structures, | 93.77 | |
| 3r62_A | 129 | H factor 1, complement factor H; immunity, repeati | 92.98 | |
| 1gkn_A | 128 | Complement receptor type 1; module, SCR, structure | 91.55 | |
| 2qy0_A | 159 | Complement C1R subcomponent; serine protease, beta | 91.48 | |
| 2a55_A | 133 | C4B-binding protein; complement, SCR, CCP module, | 90.45 | |
| 3erb_A | 223 | Complement C2; C3/C5 convertase, short consensus r | 89.66 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 88.17 | |
| 3gov_A | 155 | MAsp-1; complement, serine protease, beta barrel, | 87.93 | |
| 1ly2_A | 130 | CD21, complement receptor type 2; epstein BARR vir | 87.67 | |
| 3erb_A | 223 | Complement C2; C3/C5 convertase, short consensus r | 86.93 | |
| 3sw0_X | 188 | H factor 1, complement factor H; innate immune res | 86.89 | |
| 3hrz_D | 741 | Complement factor B; serine protease, glycosilated | 86.81 | |
| 1gkg_A | 136 | Complement receptor type 1; module, SCR, structure | 85.23 | |
| 4ayi_A | 125 | H factor 1, complement factor H; immune system, an | 85.16 | |
| 2aty_A | 376 | Complement receptor chimeric conjugate CR2-IG; imm | 85.05 | |
| 1qub_A | 319 | Protein (human BETA2-glycoprotein I); short consen | 84.77 | |
| 3o8e_B | 252 | Membrane cofactor protein; short consensus repeat, | 81.65 | |
| 1ntl_A | 551 | CRRY-IG; immunology, complement, glycoprotein, SCR | 80.56 | |
| 1ok3_A | 254 | CD55, CR, DAF, complement decay-accelerating facto | 80.56 |
| >3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B | Back alignment and structure |
|---|
Probab=99.94 E-value=1.1e-27 Score=173.78 Aligned_cols=87 Identities=30% Similarity=0.775 Sum_probs=76.7
Q ss_pred ccccccccccCCCCCCCCCCCcccccccccCCCCCCCceEEecCCccccccccccceeeeeCCCCeEEecCCCCcccccc
Q psy15495 7 SSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNY 86 (158)
Q Consensus 7 ~~~~~~~~~~~~~~~~~~~~C~~~wD~~~CWp~t~~G~~v~~~CP~~~~~~~~~~~a~R~C~~dG~W~~~p~t~~~wtnY 86 (158)
..+|.++++.++++...+++|+++||+++|||++++|++|+++||.||.+|+..++|+|+|+.+|+|..+++++++|+||
T Consensus 27 ~~~C~~~l~~~~~~~~~~~~C~~twD~~~CWp~t~~G~~v~~~CP~~~~~f~~~g~v~R~C~~~G~W~~~~~~~~~w~NY 106 (115)
T 3n7s_A 27 QYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNY 106 (115)
T ss_dssp HHHHHHHHTSCCC---CCSEECCEECSSCEECCEETTCEEEEECCSSSTTCCTTSEEEEEBCTTSCBCBCTTTCSBCCBC
T ss_pred HHHHHHHHHhCCCCCCCCCCCcCcccccccCCCCCCCCEEEecCchhhcCCCCCCcEEeecCCCCCcccCCCCCCCcCCh
Confidence 34788899888887667899999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCcc
Q psy15495 87 TTCIDIE 93 (158)
Q Consensus 87 t~C~~~~ 93 (158)
+.|..+.
T Consensus 107 s~C~~~~ 113 (115)
T 3n7s_A 107 TQCNVNT 113 (115)
T ss_dssp GGGC---
T ss_pred hhhhhcc
Confidence 9998764
|
| >4ers_A GL-R, glucagon receptor; class-B GPCR, FAB, glycosylation, extra-C immune system; HET: NAG; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5t_A Glucagon-like peptide 1 receptor; ligand-bound G protein-coupled receptor extracellular domain protein coupled receptor, glycoprotein, membrane; HET: 10M; 2.10A {Homo sapiens} PDB: 3c59_A* 3iol_A* | Back alignment and structure |
|---|
| >2qkh_A Glucose-dependent insulinotropic polypeptide receptor; GPCR, incretin, hormone-GPCR complex, extracellular domain, ligand binding domain, ECD; HET: QKH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2l27_A Seven transmembrane helix receptor; CRF, ECD1, family B1, alpha helical CRF, membrane P peptide binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xdg_A Growth hormone-releasing hormone receptor; signaling protein, membrane protein; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1u34_A CRFR2B, corticotropin releasing factor receptor 2; beta sheets and loops, signaling protein; NMR {Mus musculus} SCOP: g.76.1.1 PDB: 2jnd_A* 2jnc_A | Back alignment and structure |
|---|
| >2x57_A Vasoactive intestinal polypeptide receptor 2; G-protein coupled receptor, circadian rhythm, MALE reproduct hormone binding, growth, transducer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2jod_A Pituitary adenylate cyclase-activating polypeptide type I receptor; protein/peptide complex, signaling protein; NMR {Homo sapiens} SCOP: g.76.1.1 | Back alignment and structure |
|---|
| >3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* | Back alignment and structure |
|---|
| >3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* | Back alignment and structure |
|---|
| >3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B | Back alignment and structure |
|---|
| >4ers_A GL-R, glucagon receptor; class-B GPCR, FAB, glycosylation, extra-C immune system; HET: NAG; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3c5t_A Glucagon-like peptide 1 receptor; ligand-bound G protein-coupled receptor extracellular domain protein coupled receptor, glycoprotein, membrane; HET: 10M; 2.10A {Homo sapiens} PDB: 3c59_A* 3iol_A* | Back alignment and structure |
|---|
| >3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* | Back alignment and structure |
|---|
| >1u34_A CRFR2B, corticotropin releasing factor receptor 2; beta sheets and loops, signaling protein; NMR {Mus musculus} SCOP: g.76.1.1 PDB: 2jnd_A* 2jnc_A | Back alignment and structure |
|---|
| >4dlq_A Latrophilin-1; GAIN domain, includes the GPS motif, hormone binding domain, autoproteolysis, A-latrotoxin, extracellular domain; HET: NAG; 1.85A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2qkh_A Glucose-dependent insulinotropic polypeptide receptor; GPCR, incretin, hormone-GPCR complex, extracellular domain, ligand binding domain, ECD; HET: QKH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2l27_A Seven transmembrane helix receptor; CRF, ECD1, family B1, alpha helical CRF, membrane P peptide binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xdg_A Growth hormone-releasing hormone receptor; signaling protein, membrane protein; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2x57_A Vasoactive intestinal polypeptide receptor 2; G-protein coupled receptor, circadian rhythm, MALE reproduct hormone binding, growth, transducer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* | Back alignment and structure |
|---|
| >2jod_A Pituitary adenylate cyclase-activating polypeptide type I receptor; protein/peptide complex, signaling protein; NMR {Homo sapiens} SCOP: g.76.1.1 | Back alignment and structure |
|---|
| >4dlo_A Brain-specific angiogenesis inhibitor 3; GAIN domain, includes GPS motif, autoproteolytic fold, extra signaling protein; HET: NAG FUL; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1bl1_A Parathyroid hormone receptor; micelle structures, calciotropic hormones, structures; NMR {Homo sapiens} SCOP: j.15.1.1 | Back alignment and structure |
|---|
| >3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C | Back alignment and structure |
|---|
| >1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 | Back alignment and structure |
|---|
| >2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A | Back alignment and structure |
|---|
| >3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A | Back alignment and structure |
|---|
| >1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C | Back alignment and structure |
|---|
| >3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* | Back alignment and structure |
|---|
| >1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A | Back alignment and structure |
|---|
| >4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A | Back alignment and structure |
|---|
| >2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A | Back alignment and structure |
|---|
| >3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* | Back alignment and structure |
|---|
| >1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 158 | ||||
| d1u34a_ | 119 | g.76.1.1 (A:) Corticotropin releasing factor recep | 9e-18 | |
| d2joda1 | 106 | g.76.1.1 (A:17-122) Pituitary adenylate cyclase-ac | 2e-16 |
| >d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 119 | Back information, alignment and structure |
|---|
class: Small proteins fold: Hormone receptor domain superfamily: Hormone receptor domain family: Hormone receptor domain domain: Corticotropin releasing factor receptor 2, CRFR-2beta species: Mouse (Mus musculus) [TaxId: 10090]
Score = 72.3 bits (177), Expect = 9e-18
Identities = 27/78 (34%), Positives = 32/78 (41%), Gaps = 10/78 (12%)
Query: 23 STLYCPTMFDGW-SCWNATLAGETARTPCPNFIVGFD--SRRFALRTCLENGTWFQHPVT 79
YC T D +CW + G PCP + G + R A R CLENGTW
Sbjct: 42 PYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWAS---- 97
Query: 80 RKFWSNYTTCIDIEDLKV 97
NY+ C I D K
Sbjct: 98 ---RVNYSHCEPILDDKQ 112
|
| >d2joda1 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-activating polypeptide type I receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 158 | |||
| d1u34a_ | 119 | Corticotropin releasing factor receptor 2, CRFR-2b | 99.84 | |
| d2joda1 | 106 | Pituitary adenylate cyclase-activating polypeptide | 99.81 | |
| d1u34a_ | 119 | Corticotropin releasing factor receptor 2, CRFR-2b | 98.5 | |
| d2joda1 | 106 | Pituitary adenylate cyclase-activating polypeptide | 94.57 | |
| d1elva2 | 68 | Complement C1S protease domain {Human (Homo sapien | 89.73 | |
| d2ok5a2 | 62 | Complement factor B {Human (Homo sapiens) [TaxId: | 88.75 | |
| d1ly2a2 | 63 | Complement receptor 2, cr2 {Human (Homo sapiens) [ | 88.64 | |
| d2ok5a4 | 68 | Complement factor B {Human (Homo sapiens) [TaxId: | 87.09 | |
| d1quba4 | 60 | beta2-glycoprotein I {Human (Homo sapiens) [TaxId: | 86.43 | |
| d1quba2 | 58 | beta2-glycoprotein I {Human (Homo sapiens) [TaxId: | 86.4 | |
| d1g40a4 | 59 | Complement control protein {Vaccinia virus [TaxId: | 86.08 | |
| d1quba3 | 63 | beta2-glycoprotein I {Human (Homo sapiens) [TaxId: | 85.79 | |
| d2ok5a3 | 61 | Complement factor B {Human (Homo sapiens) [TaxId: | 85.38 | |
| d1zjka2 | 53 | Complement C1R protease domains {Human (Homo sapie | 83.98 | |
| d1hfia_ | 62 | Factor H, 15th and 16th modules {Human (Homo sapie | 82.97 | |
| d2o39c1 | 62 | CD46 (membrane cofactor protein, MCP) {Human (Homo | 82.45 | |
| d1q3xa2 | 75 | Mannan-binding lectin serine protease 2 (MASP-2) d | 82.01 | |
| d1ok3a1 | 64 | Complement decay-accelerating factor (Daf, CD55) { | 80.89 |
| >d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Hormone receptor domain superfamily: Hormone receptor domain family: Hormone receptor domain domain: Corticotropin releasing factor receptor 2, CRFR-2beta species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.84 E-value=3e-22 Score=143.67 Aligned_cols=63 Identities=41% Similarity=0.908 Sum_probs=57.2
Q ss_pred CCCccccccc-ccCCCCCCCceEEecCCcccccc--ccccceeeeeCCCCeEEecCCCCccccccccccCcch
Q psy15495 25 LYCPTMFDGW-SCWNATLAGETARTPCPNFIVGF--DSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIED 94 (158)
Q Consensus 25 ~~C~~~wD~~-~CWp~t~~G~~v~~~CP~~~~~~--~~~~~a~R~C~~dG~W~~~p~t~~~wtnYt~C~~~~~ 94 (158)
.+|+++||+| +|||+|++|++|++|||+||.++ ++.++|+|+|+.+|+|. .|+||+.|....+
T Consensus 44 ~~C~~twD~i~~CWP~T~aG~~v~~pCP~~~~g~~~~~~~~a~R~C~~nG~W~-------~~sNYt~C~~~~~ 109 (119)
T d1u34a_ 44 TYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWA-------SRVNYSHCEPILD 109 (119)
T ss_dssp SCCCCBCCSSSCCBCCCCTTCBCCCCSSCTTSSSCCCCCCCCCCBCCTTSCCC-------SCCCCCSSSCCSS
T ss_pred CCCCCcCCCCcccCCCCCCCCEEEecCChhhccccccccceEEEecCCCccCC-------CcCCchhcccccc
Confidence 6999999999 89999999999999999999875 57899999999999995 6899999977643
|
| >d2joda1 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-activating polypeptide type I receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2joda1 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-activating polypeptide type I receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} | Back information, alignment and structure |
|---|
| >d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|