Psyllid ID: psy15495


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MYHLGTSSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTIDR
ccccccHHHHHHHHHHcccccccccccccccccEEEccccccccEEEcccccccccccccccEEEEcccccEEEEcccccccccccccccccccHHHHEEEccEEcccccHHHHHHHHHEEEEEcccEEccccccccccccccccccccccccccccc
cccEcHHHHHHHcccccccccccccccccccccEEEcccccccEEEEEccccccccccccccEEEEEcccccEEEccccccccccccccccccHHHHHHHHHHHHcccccccEEEHHHHHHHHcccccEEEcccccccccEcEEEEcHHHcccccccc
myhlgtssLTTLNFMFQTlsldstlycptmfdgwscwnatlagetartpcpnfivgfDSRRFALRTCLengtwfqhpvtrkfwsnyttcidiedLKVYLFLSCCfngkknglIINLRFALRTCLengtwfqhpvtrkfwsnyttcidiedlkvstidr
myhlgtssLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENgtwfqhpvtrkfwSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTwfqhpvtrkfwsnyttcidiedlkvstidr
MYHLGTSSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTIDR
*******SLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKV*****
MYHLG**SL****************YCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTI**
MYHLGTSSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTIDR
MYHLGTSSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVST***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYHLGTSSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLSCCFNGKKNGLIINLRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIEDLKVSTIDR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query158 2.2.26 [Sep-21-2011]
Q60755 515 Calcitonin receptor OS=Mu yes N/A 0.411 0.126 0.476 1e-12
P32214 516 Calcitonin receptor OS=Ra yes N/A 0.405 0.124 0.437 3e-12
P25117 498 Calcitonin receptor OS=Su yes N/A 0.411 0.130 0.446 2e-11
A6QP74 462 Calcitonin gene-related p no N/A 0.411 0.140 0.384 2e-11
Q8WN93 462 Calcitonin gene-related p no N/A 0.411 0.140 0.384 4e-11
Q16602 461 Calcitonin gene-related p yes N/A 0.411 0.140 0.384 5e-11
Q9IB86 465 Calcitonin gene-related p N/A N/A 0.468 0.159 0.379 5e-11
Q63118 464 Calcitonin gene-related p no N/A 0.481 0.163 0.355 6e-11
Q9R1W5 463 Calcitonin gene-related p no N/A 0.411 0.140 0.4 8e-11
Q8AXU4 465 Calcitonin gene-related p N/A N/A 0.398 0.135 0.412 2e-10
>sp|Q60755|CALCR_MOUSE Calcitonin receptor OS=Mus musculus GN=Calcr PE=2 SV=1 Back     alignment and function desciption
 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 31/65 (47%), Positives = 40/65 (61%)

Query: 25  LYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWS 84
           LYC   +DGW CW+ T AG TA   CP++   FD+     + C ENG WF+HP + + WS
Sbjct: 70  LYCNRTWDGWMCWDDTPAGATAYQHCPDYFPDFDTAEKVSKYCDENGEWFRHPDSNRTWS 129

Query: 85  NYTTC 89
           NYT C
Sbjct: 130 NYTLC 134




This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.
Mus musculus (taxid: 10090)
>sp|P32214|CALCR_RAT Calcitonin receptor OS=Rattus norvegicus GN=Calcr PE=2 SV=1 Back     alignment and function description
>sp|P25117|CALCR_PIG Calcitonin receptor OS=Sus scrofa GN=CALCR PE=2 SV=2 Back     alignment and function description
>sp|A6QP74|CALRL_BOVIN Calcitonin gene-related peptide type 1 receptor OS=Bos taurus GN=CALCRL PE=2 SV=2 Back     alignment and function description
>sp|Q8WN93|CALRL_PIG Calcitonin gene-related peptide type 1 receptor OS=Sus scrofa GN=CALCRL PE=1 SV=1 Back     alignment and function description
>sp|Q16602|CALRL_HUMAN Calcitonin gene-related peptide type 1 receptor OS=Homo sapiens GN=CALCRL PE=1 SV=2 Back     alignment and function description
>sp|Q9IB86|CALRL_PAROL Calcitonin gene-related peptide type 1 receptor OS=Paralichthys olivaceus GN=calcrl PE=2 SV=1 Back     alignment and function description
>sp|Q63118|CALRL_RAT Calcitonin gene-related peptide type 1 receptor OS=Rattus norvegicus GN=Calcrl PE=2 SV=1 Back     alignment and function description
>sp|Q9R1W5|CALRL_MOUSE Calcitonin gene-related peptide type 1 receptor OS=Mus musculus GN=Calcrl PE=2 SV=2 Back     alignment and function description
>sp|Q8AXU4|CALRL_ONCGO Calcitonin gene-related peptide type 1 receptor OS=Oncorhynchus gorbuscha GN=calcrl PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
328715789 466 PREDICTED: calcitonin gene-related pepti 0.481 0.163 0.605 1e-22
321458499 377 putative DH31 receptor [Daphnia pulex] 0.462 0.193 0.602 5e-22
118795187 427 AGAP001175-PA [Anopheles gambiae str. PE 0.474 0.175 0.6 2e-21
345481443 411 PREDICTED: calcitonin receptor-like isof 0.449 0.172 0.619 4e-20
345481445 492 PREDICTED: calcitonin receptor-like isof 0.449 0.144 0.619 5e-20
157113539 544 calcitonin receptor [Aedes aegypti] 0.474 0.137 0.52 2e-19
170052362 451 calcitonin receptor [Culex quinquefascia 0.449 0.157 0.549 2e-19
403182794 422 AAEL006490-PA, partial [Aedes aegypti] 0.468 0.175 0.527 2e-19
357612140 410 neuropeptide receptor B4 [Danaus plexipp 0.468 0.180 0.527 4e-19
340721170 466 PREDICTED: calcitonin receptor-like [Bom 0.449 0.152 0.577 6e-19
>gi|328715789|ref|XP_001945278.2| PREDICTED: calcitonin gene-related peptide type 1 receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 46/76 (60%), Positives = 60/76 (78%)

Query: 22  DSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRK 81
           DS  +CP  FDGW+C N T AGE A+ PCP FI+GFD++RF  +TCL +G+WF+HP + K
Sbjct: 39  DSDAWCPGEFDGWTCINRTKAGEVAKFPCPYFILGFDTKRFGQKTCLPDGSWFKHPDSNK 98

Query: 82  FWSNYTTCIDIEDLKV 97
            WSNYTTC+D+EDLK+
Sbjct: 99  TWSNYTTCVDLEDLKL 114




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|321458499|gb|EFX69566.1| putative DH31 receptor [Daphnia pulex] Back     alignment and taxonomy information
>gi|118795187|ref|XP_321982.3| AGAP001175-PA [Anopheles gambiae str. PEST] gi|116116654|gb|EAA00956.4| AGAP001175-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|345481443|ref|XP_001601649.2| PREDICTED: calcitonin receptor-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345481445|ref|XP_003424370.1| PREDICTED: calcitonin receptor-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|157113539|ref|XP_001651988.1| calcitonin receptor [Aedes aegypti] Back     alignment and taxonomy information
>gi|170052362|ref|XP_001862186.1| calcitonin receptor [Culex quinquefasciatus] gi|167873341|gb|EDS36724.1| calcitonin receptor [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|403182794|gb|EAT41922.2| AAEL006490-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
>gi|357612140|gb|EHJ67831.1| neuropeptide receptor B4 [Danaus plexippus] Back     alignment and taxonomy information
>gi|340721170|ref|XP_003398998.1| PREDICTED: calcitonin receptor-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query158
FB|FBgn0030437 486 hec "hector" [Drosophila melan 0.588 0.191 0.430 6.1e-20
FB|FBgn0052843 443 Dh31-R1 "Diuretic hormone 31 r 0.443 0.158 0.528 1.6e-18
ZFIN|ZDB-GENE-060503-420 598 calcr "calcitonin receptor" [D 0.430 0.113 0.485 1.6e-14
MGI|MGI:101950 515 Calcr "calcitonin receptor" [M 0.411 0.126 0.476 4.2e-14
UNIPROTKB|F1SFC3 498 CALCR "Calcitonin receptor" [S 0.411 0.130 0.446 7.8e-13
UNIPROTKB|P25117 498 CALCR "Calcitonin receptor" [S 0.411 0.130 0.446 7.8e-13
UNIPROTKB|F1P5E1 469 CALCR "Uncharacterized protein 0.487 0.164 0.405 8.9e-13
UNIPROTKB|F1NH61 470 CALCR "Uncharacterized protein 0.487 0.163 0.405 8.9e-13
UNIPROTKB|G3X6P6 462 CALCRL "Calcitonin gene-relate 0.436 0.149 0.376 1.4e-12
UNIPROTKB|A6QP74 462 CALCRL "Calcitonin gene-relate 0.411 0.140 0.384 1.8e-12
FB|FBgn0030437 hec "hector" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 6.1e-20, P = 6.1e-20
 Identities = 40/93 (43%), Positives = 60/93 (64%)

Query:    10 TTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLE 69
             T ++    T   ++ L+CP  FDG+ CW  T AG      CP+F+ GF+ +  A +TCLE
Sbjct:   103 TVVSATMATNQKENRLFCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFLAHKTCLE 162

Query:    70 NGTWFQHPVTRKFWSNYTTCIDIEDLKVYLFLS 102
             NG+W++HPV+ + WSNYT C+D EDL+   F++
Sbjct:   163 NGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFIN 195


GO:0007186 "G-protein coupled receptor signaling pathway" evidence=IEA;ISS
GO:0016021 "integral to membrane" evidence=IEA;ISS
GO:0004948 "calcitonin receptor activity" evidence=IEA;ISS
GO:0008188 "neuropeptide receptor activity" evidence=ISS
GO:0008049 "male courtship behavior" evidence=IMP
FB|FBgn0052843 Dh31-R1 "Diuretic hormone 31 receptor 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060503-420 calcr "calcitonin receptor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:101950 Calcr "calcitonin receptor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1SFC3 CALCR "Calcitonin receptor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P25117 CALCR "Calcitonin receptor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5E1 CALCR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH61 CALCR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3X6P6 CALCRL "Calcitonin gene-related peptide type 1 receptor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6QP74 CALCRL "Calcitonin gene-related peptide type 1 receptor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
pfam0279363 pfam02793, HRM, Hormone receptor domain 8e-21
smart0000870 smart00008, HormR, Domain present in hormone recep 3e-15
>gnl|CDD|202399 pfam02793, HRM, Hormone receptor domain Back     alignment and domain information
 Score = 80.1 bits (198), Expect = 8e-21
 Identities = 29/69 (42%), Positives = 34/69 (49%), Gaps = 6/69 (8%)

Query: 24 TLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFW 83
           L CP  +DG  CW  T AG T   PCP++   FD    A R C ENGTW +HP      
Sbjct: 1  GLGCPRTWDGILCWPRTPAGTTVEVPCPDYFYDFDPTGNASRNCTENGTWSEHP------ 54

Query: 84 SNYTTCIDI 92
           NY+ C   
Sbjct: 55 PNYSNCTSN 63


This extracellular domain contains four conserved cysteines that probably for disulphide bridges. The domain is found in a variety of hormone receptors. It may be a ligand binding domain. Length = 63

>gnl|CDD|214468 smart00008, HormR, Domain present in hormone receptors Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 158
KOG4564|consensus 473 99.93
smart0000870 HormR Domain present in hormone receptors. 99.78
PF0279366 HRM: Hormone receptor domain; InterPro: IPR001879 99.75
KOG4564|consensus 473 98.8
smart0000870 HormR Domain present in hormone receptors. 97.73
PF0279366 HRM: Hormone receptor domain; InterPro: IPR001879 97.58
PHA02831268 EEV host range protein; Provisional 93.4
PHA02817225 EEV Host range protein; Provisional 92.82
PHA02639295 EEV host range protein; Provisional 90.23
KOG4289|consensus 2531 90.21
smart0003257 CCP Domain abundant in complement control proteins 88.05
cd0003357 CCP Complement control protein (CCP) modules (aka 87.78
PF0008456 Sushi: Sushi domain (SCR repeat); InterPro: IPR000 81.95
PHA02927263 secreted complement-binding protein; Provisional 81.21
PHA02639 295 EEV host range protein; Provisional 81.06
>KOG4564|consensus Back     alignment and domain information
Probab=99.93  E-value=4.6e-27  Score=205.23  Aligned_cols=117  Identities=29%  Similarity=0.538  Sum_probs=99.0

Q ss_pred             ccccccccCCCCCCCCCCCcccccccccCCCCCCCceEEecCCccccccc--cccceeeeeCCCCeEEecCCCCcccccc
Q psy15495          9 LTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFD--SRRFALRTCLENGTWFQHPVTRKFWSNY   86 (158)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~C~~~wD~~~CWp~t~~G~~v~~~CP~~~~~~~--~~~~a~R~C~~dG~W~~~p~t~~~wtnY   86 (158)
                      .|.+.++.+++..+ +.+||++||+++|||+|++|++|.++||+||++|+  .+++|+|+|++||+|..+|.. ++|+||
T Consensus        47 ~c~~~l~~~~~~~~-~~~Cn~twD~~lCWp~t~~G~~v~~~CP~yf~~~~~~~~~~v~R~C~~~G~W~~~~~~-~~W~ny  124 (473)
T KOG4564|consen   47 QCLEELALEPPYSA-GLGCNGTWDGILCWPRTPAGTLVTVPCPDYFPGFSYSTSGNVTRNCTSNGTWSERPPS-RTWTNY  124 (473)
T ss_pred             HHHHHHHhCCCccC-CCCCCCcCCccccCCCCCCCceEEecCccccCCCcccCCCceEeecCCCCccCCCCCc-CCCCCc
Confidence            45556666655533 78999999999999999999999999999999997  789999999999999999888 899999


Q ss_pred             ccccCcchHH-----HHHhhhceecceeeeeeee-----------cceeEeeeCCCC
Q psy15495         87 TTCIDIEDLK-----VYLFLSCCFNGKKNGLIIN-----------LRFALRTCLENG  127 (158)
Q Consensus        87 t~C~~~~~~~-----~~~~~~~ly~gytvgys~~-----------~~~a~k~C~~nG  127 (158)
                      ++|...++.+     ...++..++++|+|||+.+           ..|...+|.||-
T Consensus       125 t~C~~~~~~~~~~~~~~~~~~~~~~lytvGyslSl~sL~vAl~If~~FR~L~CtRn~  181 (473)
T KOG4564|consen  125 TACGKNEEEEERQLDREYFLELLKILYTVGYSLSLVSLLVALIIFLYFRSLHCTRNY  181 (473)
T ss_pred             hhccCcchhhhhcchHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhcchHHH
Confidence            9999886543     3357777889999999888           246788898875



>smart00008 HormR Domain present in hormone receptors Back     alignment and domain information
>PF02793 HRM: Hormone receptor domain; InterPro: IPR001879 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>KOG4564|consensus Back     alignment and domain information
>smart00008 HormR Domain present in hormone receptors Back     alignment and domain information
>PF02793 HRM: Hormone receptor domain; InterPro: IPR001879 G-protein-coupled receptors, GPCRs, constitute a vast protein family that encompasses a wide range of functions (including various autocrine, paracrine and endocrine processes) Back     alignment and domain information
>PHA02831 EEV host range protein; Provisional Back     alignment and domain information
>PHA02817 EEV Host range protein; Provisional Back     alignment and domain information
>PHA02639 EEV host range protein; Provisional Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>smart00032 CCP Domain abundant in complement control proteins; SUSHI repeat; short complement-like repeat (SCR) Back     alignment and domain information
>cd00033 CCP Complement control protein (CCP) modules (aka short consensus repeats SCRs or SUSHI repeats) have been identified in several proteins of the complement system Back     alignment and domain information
>PF00084 Sushi: Sushi domain (SCR repeat); InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins Back     alignment and domain information
>PHA02927 secreted complement-binding protein; Provisional Back     alignment and domain information
>PHA02639 EEV host range protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
3n7r_A115 Crystal Structure Of The Ectodomain Complex Of The 2e-12
3aqf_B121 Crystal Structure Of The Human CrlrRAMP2 EXTRACELLU 4e-12
3n7p_A115 Crystal Structure Of The Ectodomain Complex Of The 4e-12
3l2j_A535 Dimeric Structure Of The Ligand-Free Extracellular 1e-08
3c4m_A539 Structure Of Human Parathyroid Hormone In Complex W 1e-08
3n93_A482 Crystal Structure Of Human Crfr2 Alpha Extracellula 6e-07
2jnd_A119 3d Nmr Structure Of Ecd1 Of Mcrf-R2b In Complex Wit 4e-05
1u34_A119 3d Nmr Structure Of The First Extracellular Domain 4e-05
2jnc_A119 Refined 3d Nmr Structure Of Ecd1 Of Mcrf-R2beta At 8e-05
3ehu_A476 Crystal Structure Of The Extracellular Domain Of Hu 6e-04
3eht_A476 Crystal Structure Of The Extracellular Domain Of Hu 6e-04
3ehs_A476 Crystal Structure Of The Extracellular Domain Of Hu 6e-04
>pdb|3N7R|A Chain A, Crystal Structure Of The Ectodomain Complex Of The Cgrp Receptor, A Class-B Gpcr, Reveals The Site Of Drug Antagonism Length = 115 Back     alignment and structure

Iteration: 1

Score = 67.8 bits (164), Expect = 2e-12, Method: Compositional matrix adjust. Identities = 26/76 (34%), Positives = 39/76 (51%) Query: 14 FMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTW 73 M + +YC +DGW CWN AG + CP++ FD + C ++G W Sbjct: 34 IMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNW 93 Query: 74 FQHPVTRKFWSNYTTC 89 F+HP + + W+NYT C Sbjct: 94 FRHPASNRTWTNYTQC 109
>pdb|3AQF|B Chain B, Crystal Structure Of The Human CrlrRAMP2 EXTRACELLULAR COMPLEX Length = 121 Back     alignment and structure
>pdb|3N7P|A Chain A, Crystal Structure Of The Ectodomain Complex Of The Cgrp Receptor, A Class-B Gpcr, Reveals The Site Of Drug Antagonism Length = 115 Back     alignment and structure
>pdb|3L2J|A Chain A, Dimeric Structure Of The Ligand-Free Extracellular Domain Of Parathyroid Hormone Receptor (Pth1r) Length = 535 Back     alignment and structure
>pdb|3C4M|A Chain A, Structure Of Human Parathyroid Hormone In Complex With The Extracellular Domain Of Its G-Protein-Coupled Receptor (Pth1r) Length = 539 Back     alignment and structure
>pdb|3N93|A Chain A, Crystal Structure Of Human Crfr2 Alpha Extracellular Domain In Complex With Urocortin 3 Length = 482 Back     alignment and structure
>pdb|2JND|A Chain A, 3d Nmr Structure Of Ecd1 Of Mcrf-R2b In Complex With Astressin Length = 119 Back     alignment and structure
>pdb|1U34|A Chain A, 3d Nmr Structure Of The First Extracellular Domain Of Crfr- 2beta, A Type B1 G-Protein Coupled Receptor Length = 119 Back     alignment and structure
>pdb|3EHU|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (crfr1) In Complex With Crf Length = 476 Back     alignment and structure
>pdb|3EHT|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (crfr1) In Complex With Crf Length = 476 Back     alignment and structure
>pdb|3EHS|A Chain A, Crystal Structure Of The Extracellular Domain Of Human Corticotropin Releasing Factor Receptor Type 1 (Crfr1) Length = 476 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query158
3n7s_A115 Calcitonin gene-related peptide type 1 receptor; G 2e-25
3n7s_A115 Calcitonin gene-related peptide type 1 receptor; G 2e-06
3c5t_A122 Glucagon-like peptide 1 receptor; ligand-bound G p 4e-24
2qkh_A135 Glucose-dependent insulinotropic polypeptide recep 5e-21
1u34_A119 CRFR2B, corticotropin releasing factor receptor 2; 1e-17
2l27_A84 Seven transmembrane helix receptor; CRF, ECD1, fam 9e-17
3h3g_A539 Fusion protein of maltose-binding periplasmic DOM 1e-15
2xdg_A92 Growth hormone-releasing hormone receptor; signali 2e-15
2x57_A116 Vasoactive intestinal polypeptide receptor 2; G-pr 3e-15
2jod_A106 Pituitary adenylate cyclase-activating polypeptide 1e-11
3n94_A475 Fusion protein of maltose-binding periplasmic Pro 5e-05
>3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B Length = 115 Back     alignment and structure
 Score = 92.9 bits (230), Expect = 2e-25
 Identities = 26/77 (33%), Positives = 39/77 (50%)

Query: 13  NFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGT 72
             M   +     +YC   +DGW CWN   AG  +   CP++   FD      + C ++G 
Sbjct: 33  KIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGN 92

Query: 73  WFQHPVTRKFWSNYTTC 89
           WF+HP + + W+NYT C
Sbjct: 93  WFRHPASNRTWTNYTQC 109


>3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B Length = 115 Back     alignment and structure
>3c5t_A Glucagon-like peptide 1 receptor; ligand-bound G protein-coupled receptor extracellular domain protein coupled receptor, glycoprotein, membrane; HET: 10M; 2.10A {Homo sapiens} PDB: 3c59_A* 3iol_A* Length = 122 Back     alignment and structure
>2qkh_A Glucose-dependent insulinotropic polypeptide receptor; GPCR, incretin, hormone-GPCR complex, extracellular domain, ligand binding domain, ECD; HET: QKH; 1.90A {Homo sapiens} Length = 135 Back     alignment and structure
>1u34_A CRFR2B, corticotropin releasing factor receptor 2; beta sheets and loops, signaling protein; NMR {Mus musculus} SCOP: g.76.1.1 PDB: 2jnd_A* 2jnc_A Length = 119 Back     alignment and structure
>2l27_A Seven transmembrane helix receptor; CRF, ECD1, family B1, alpha helical CRF, membrane P peptide binding protein; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Length = 539 Back     alignment and structure
>2xdg_A Growth hormone-releasing hormone receptor; signaling protein, membrane protein; 1.95A {Homo sapiens} Length = 92 Back     alignment and structure
>2x57_A Vasoactive intestinal polypeptide receptor 2; G-protein coupled receptor, circadian rhythm, MALE reproduct hormone binding, growth, transducer; 2.10A {Homo sapiens} Length = 116 Back     alignment and structure
>2jod_A Pituitary adenylate cyclase-activating polypeptide type I receptor; protein/peptide complex, signaling protein; NMR {Homo sapiens} SCOP: g.76.1.1 Length = 106 Back     alignment and structure
>3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Length = 475 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
3n7s_A115 Calcitonin gene-related peptide type 1 receptor; G 99.94
4ers_A96 GL-R, glucagon receptor; class-B GPCR, FAB, glycos 99.93
3c5t_A122 Glucagon-like peptide 1 receptor; ligand-bound G p 99.92
2qkh_A135 Glucose-dependent insulinotropic polypeptide recep 99.89
2l27_A84 Seven transmembrane helix receptor; CRF, ECD1, fam 99.87
2xdg_A92 Growth hormone-releasing hormone receptor; signali 99.86
1u34_A119 CRFR2B, corticotropin releasing factor receptor 2; 99.85
2x57_A116 Vasoactive intestinal polypeptide receptor 2; G-pr 99.84
2jod_A106 Pituitary adenylate cyclase-activating polypeptide 99.84
3h3g_A539 Fusion protein of maltose-binding periplasmic DOM 99.83
3n94_A475 Fusion protein of maltose-binding periplasmic Pro 99.74
3n7s_A115 Calcitonin gene-related peptide type 1 receptor; G 99.12
4ers_A96 GL-R, glucagon receptor; class-B GPCR, FAB, glycos 99.05
3c5t_A122 Glucagon-like peptide 1 receptor; ligand-bound G p 98.87
3h3g_A539 Fusion protein of maltose-binding periplasmic DOM 98.71
1u34_A119 CRFR2B, corticotropin releasing factor receptor 2; 98.26
4dlq_A 381 Latrophilin-1; GAIN domain, includes the GPS motif 98.14
2qkh_A135 Glucose-dependent insulinotropic polypeptide recep 98.09
2l27_A84 Seven transmembrane helix receptor; CRF, ECD1, fam 98.0
2xdg_A92 Growth hormone-releasing hormone receptor; signali 97.34
2x57_A116 Vasoactive intestinal polypeptide receptor 2; G-pr 97.19
3n94_A475 Fusion protein of maltose-binding periplasmic Pro 97.07
2jod_A106 Pituitary adenylate cyclase-activating polypeptide 96.88
4dlo_A 382 Brain-specific angiogenesis inhibitor 3; GAIN doma 96.65
1bl1_A31 Parathyroid hormone receptor; micelle structures, 93.77
3r62_A129 H factor 1, complement factor H; immunity, repeati 92.98
1gkn_A128 Complement receptor type 1; module, SCR, structure 91.55
2qy0_A159 Complement C1R subcomponent; serine protease, beta 91.48
2a55_A133 C4B-binding protein; complement, SCR, CCP module, 90.45
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 89.66
1qub_A 319 Protein (human BETA2-glycoprotein I); short consen 88.17
3gov_A155 MAsp-1; complement, serine protease, beta barrel, 87.93
1ly2_A130 CD21, complement receptor type 2; epstein BARR vir 87.67
3erb_A223 Complement C2; C3/C5 convertase, short consensus r 86.93
3sw0_X188 H factor 1, complement factor H; innate immune res 86.89
3hrz_D 741 Complement factor B; serine protease, glycosilated 86.81
1gkg_A136 Complement receptor type 1; module, SCR, structure 85.23
4ayi_A125 H factor 1, complement factor H; immune system, an 85.16
2aty_A 376 Complement receptor chimeric conjugate CR2-IG; imm 85.05
1qub_A319 Protein (human BETA2-glycoprotein I); short consen 84.77
3o8e_B252 Membrane cofactor protein; short consensus repeat, 81.65
1ntl_A 551 CRRY-IG; immunology, complement, glycoprotein, SCR 80.56
1ok3_A 254 CD55, CR, DAF, complement decay-accelerating facto 80.56
>3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B Back     alignment and structure
Probab=99.94  E-value=1.1e-27  Score=173.78  Aligned_cols=87  Identities=30%  Similarity=0.775  Sum_probs=76.7

Q ss_pred             ccccccccccCCCCCCCCCCCcccccccccCCCCCCCceEEecCCccccccccccceeeeeCCCCeEEecCCCCcccccc
Q psy15495          7 SSLTTLNFMFQTLSLDSTLYCPTMFDGWSCWNATLAGETARTPCPNFIVGFDSRRFALRTCLENGTWFQHPVTRKFWSNY   86 (158)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~~~C~~~wD~~~CWp~t~~G~~v~~~CP~~~~~~~~~~~a~R~C~~dG~W~~~p~t~~~wtnY   86 (158)
                      ..+|.++++.++++...+++|+++||+++|||++++|++|+++||.||.+|+..++|+|+|+.+|+|..+++++++|+||
T Consensus        27 ~~~C~~~l~~~~~~~~~~~~C~~twD~~~CWp~t~~G~~v~~~CP~~~~~f~~~g~v~R~C~~~G~W~~~~~~~~~w~NY  106 (115)
T 3n7s_A           27 QYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNY  106 (115)
T ss_dssp             HHHHHHHHTSCCC---CCSEECCEECSSCEECCEETTCEEEEECCSSSTTCCTTSEEEEEBCTTSCBCBCTTTCSBCCBC
T ss_pred             HHHHHHHHHhCCCCCCCCCCCcCcccccccCCCCCCCCEEEecCchhhcCCCCCCcEEeecCCCCCcccCCCCCCCcCCh
Confidence            34788899888887667899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCcc
Q psy15495         87 TTCIDIE   93 (158)
Q Consensus        87 t~C~~~~   93 (158)
                      +.|..+.
T Consensus       107 s~C~~~~  113 (115)
T 3n7s_A          107 TQCNVNT  113 (115)
T ss_dssp             GGGC---
T ss_pred             hhhhhcc
Confidence            9998764



>4ers_A GL-R, glucagon receptor; class-B GPCR, FAB, glycosylation, extra-C immune system; HET: NAG; 2.64A {Homo sapiens} Back     alignment and structure
>3c5t_A Glucagon-like peptide 1 receptor; ligand-bound G protein-coupled receptor extracellular domain protein coupled receptor, glycoprotein, membrane; HET: 10M; 2.10A {Homo sapiens} PDB: 3c59_A* 3iol_A* Back     alignment and structure
>2qkh_A Glucose-dependent insulinotropic polypeptide receptor; GPCR, incretin, hormone-GPCR complex, extracellular domain, ligand binding domain, ECD; HET: QKH; 1.90A {Homo sapiens} Back     alignment and structure
>2l27_A Seven transmembrane helix receptor; CRF, ECD1, family B1, alpha helical CRF, membrane P peptide binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xdg_A Growth hormone-releasing hormone receptor; signaling protein, membrane protein; 1.95A {Homo sapiens} Back     alignment and structure
>1u34_A CRFR2B, corticotropin releasing factor receptor 2; beta sheets and loops, signaling protein; NMR {Mus musculus} SCOP: g.76.1.1 PDB: 2jnd_A* 2jnc_A Back     alignment and structure
>2x57_A Vasoactive intestinal polypeptide receptor 2; G-protein coupled receptor, circadian rhythm, MALE reproduct hormone binding, growth, transducer; 2.10A {Homo sapiens} Back     alignment and structure
>2jod_A Pituitary adenylate cyclase-activating polypeptide type I receptor; protein/peptide complex, signaling protein; NMR {Homo sapiens} SCOP: g.76.1.1 Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Back     alignment and structure
>3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Back     alignment and structure
>3n7s_A Calcitonin gene-related peptide type 1 receptor; GPCR, class B GPCR, antagonist, olcegepant, telcagepant, MIG membrane protein; HET: 3N6 3N7; 2.10A {Homo sapiens} PDB: 3n7r_A* 3n7p_A* 3aqf_B Back     alignment and structure
>4ers_A GL-R, glucagon receptor; class-B GPCR, FAB, glycosylation, extra-C immune system; HET: NAG; 2.64A {Homo sapiens} Back     alignment and structure
>3c5t_A Glucagon-like peptide 1 receptor; ligand-bound G protein-coupled receptor extracellular domain protein coupled receptor, glycoprotein, membrane; HET: 10M; 2.10A {Homo sapiens} PDB: 3c59_A* 3iol_A* Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Back     alignment and structure
>1u34_A CRFR2B, corticotropin releasing factor receptor 2; beta sheets and loops, signaling protein; NMR {Mus musculus} SCOP: g.76.1.1 PDB: 2jnd_A* 2jnc_A Back     alignment and structure
>4dlq_A Latrophilin-1; GAIN domain, includes the GPS motif, hormone binding domain, autoproteolysis, A-latrotoxin, extracellular domain; HET: NAG; 1.85A {Rattus norvegicus} Back     alignment and structure
>2qkh_A Glucose-dependent insulinotropic polypeptide receptor; GPCR, incretin, hormone-GPCR complex, extracellular domain, ligand binding domain, ECD; HET: QKH; 1.90A {Homo sapiens} Back     alignment and structure
>2l27_A Seven transmembrane helix receptor; CRF, ECD1, family B1, alpha helical CRF, membrane P peptide binding protein; NMR {Homo sapiens} Back     alignment and structure
>2xdg_A Growth hormone-releasing hormone receptor; signaling protein, membrane protein; 1.95A {Homo sapiens} Back     alignment and structure
>2x57_A Vasoactive intestinal polypeptide receptor 2; G-protein coupled receptor, circadian rhythm, MALE reproduct hormone binding, growth, transducer; 2.10A {Homo sapiens} Back     alignment and structure
>3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Back     alignment and structure
>2jod_A Pituitary adenylate cyclase-activating polypeptide type I receptor; protein/peptide complex, signaling protein; NMR {Homo sapiens} SCOP: g.76.1.1 Back     alignment and structure
>4dlo_A Brain-specific angiogenesis inhibitor 3; GAIN domain, includes GPS motif, autoproteolytic fold, extra signaling protein; HET: NAG FUL; 2.30A {Homo sapiens} Back     alignment and structure
>1bl1_A Parathyroid hormone receptor; micelle structures, calciotropic hormones, structures; NMR {Homo sapiens} SCOP: j.15.1.1 Back     alignment and structure
>3r62_A H factor 1, complement factor H; immunity, repeating sushi domain, regulator of C activation, C3D, immune system; 1.52A {Homo sapiens} PDB: 2bzm_A 3oxu_D 3rj3_D 2g7i_A 3kxv_A 3kzj_A 2xqw_C Back     alignment and structure
>1gkn_A Complement receptor type 1; module, SCR, structure; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 Back     alignment and structure
>2qy0_A Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} Back     alignment and structure
>2a55_A C4B-binding protein; complement, SCR, CCP module, immune system; NMR {Homo sapiens} Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Back     alignment and structure
>3gov_A MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_A Back     alignment and structure
>1ly2_A CD21, complement receptor type 2; epstein BARR virus, regulator of comple activation, short consensus repeat, viral receptor; HET: NAG; 1.80A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1w2r_A 1w2s_B 1ghq_B* 3oed_C Back     alignment and structure
>3erb_A Complement C2; C3/C5 convertase, short consensus repeat(SCR), sushi domain, human complement system, complement second component C2; 1.80A {Homo sapiens} Back     alignment and structure
>3sw0_X H factor 1, complement factor H; innate immune response, sushi domains, cofactor in the inact of C3B, C3B, human plasma, immune system; 1.80A {Homo sapiens} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1gkg_A Complement receptor type 1; module, SCR, structure, sushi; NMR {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 PDB: 1ppq_A Back     alignment and structure
>4ayi_A H factor 1, complement factor H; immune system, antigens; 2.31A {Homo sapiens} PDB: 4aye_A 4ayd_A 4aym_A 2w80_A 2w81_A 2jgw_A 2jgx_A Back     alignment and structure
>2aty_A Complement receptor chimeric conjugate CR2-IG; immunoglobulin fold, antibody, immune system; NMR {Homo sapiens} Back     alignment and structure
>1qub_A Protein (human BETA2-glycoprotein I); short consensus repeat, sushi, complement control protein, N glycosylation, multi-domain, membrane adhesion; HET: NAG MAN; 2.70A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1c1z_A* 1g4f_A 1g4g_A 2kri_A 3op8_A Back     alignment and structure
>3o8e_B Membrane cofactor protein; short consensus repeat, complement control protein, fiber KN virus-receptor interaction, cell adhesion-immunity complex; HET: NAG; 2.84A {Homo sapiens} PDB: 2o39_C* 1ckl_A* 3inb_C* 3l89_M* Back     alignment and structure
>1ntl_A CRRY-IG; immunology, complement, glycoprotein, SCR, CCP, immune system; NMR {Mus musculus} Back     alignment and structure
>1ok3_A CD55, CR, DAF, complement decay-accelerating factor; regulator of complement pathway, regulator of complement; 2.2A {Homo sapiens} SCOP: g.18.1.1 g.18.1.1 g.18.1.1 g.18.1.1 PDB: 1ojw_A 1ojy_A 1ok1_A 1ok2_A 1ojv_A 1ok9_A 1m11_R 1nwv_A 2qzh_A 2qzf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 158
d1u34a_119 g.76.1.1 (A:) Corticotropin releasing factor recep 9e-18
d2joda1106 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-ac 2e-16
>d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 119 Back     information, alignment and structure

class: Small proteins
fold: Hormone receptor domain
superfamily: Hormone receptor domain
family: Hormone receptor domain
domain: Corticotropin releasing factor receptor 2, CRFR-2beta
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 72.3 bits (177), Expect = 9e-18
 Identities = 27/78 (34%), Positives = 32/78 (41%), Gaps = 10/78 (12%)

Query: 23  STLYCPTMFDGW-SCWNATLAGETARTPCPNFIVGFD--SRRFALRTCLENGTWFQHPVT 79
              YC T  D   +CW  +  G     PCP +  G    + R A R CLENGTW      
Sbjct: 42  PYTYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWAS---- 97

Query: 80  RKFWSNYTTCIDIEDLKV 97
                NY+ C  I D K 
Sbjct: 98  ---RVNYSHCEPILDDKQ 112


>d2joda1 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-activating polypeptide type I receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query158
d1u34a_119 Corticotropin releasing factor receptor 2, CRFR-2b 99.84
d2joda1106 Pituitary adenylate cyclase-activating polypeptide 99.81
d1u34a_119 Corticotropin releasing factor receptor 2, CRFR-2b 98.5
d2joda1106 Pituitary adenylate cyclase-activating polypeptide 94.57
d1elva268 Complement C1S protease domain {Human (Homo sapien 89.73
d2ok5a262 Complement factor B {Human (Homo sapiens) [TaxId: 88.75
d1ly2a263 Complement receptor 2, cr2 {Human (Homo sapiens) [ 88.64
d2ok5a468 Complement factor B {Human (Homo sapiens) [TaxId: 87.09
d1quba460 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 86.43
d1quba258 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 86.4
d1g40a459 Complement control protein {Vaccinia virus [TaxId: 86.08
d1quba363 beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 85.79
d2ok5a361 Complement factor B {Human (Homo sapiens) [TaxId: 85.38
d1zjka253 Complement C1R protease domains {Human (Homo sapie 83.98
d1hfia_62 Factor H, 15th and 16th modules {Human (Homo sapie 82.97
d2o39c162 CD46 (membrane cofactor protein, MCP) {Human (Homo 82.45
d1q3xa275 Mannan-binding lectin serine protease 2 (MASP-2) d 82.01
d1ok3a164 Complement decay-accelerating factor (Daf, CD55) { 80.89
>d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: Hormone receptor domain
superfamily: Hormone receptor domain
family: Hormone receptor domain
domain: Corticotropin releasing factor receptor 2, CRFR-2beta
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.84  E-value=3e-22  Score=143.67  Aligned_cols=63  Identities=41%  Similarity=0.908  Sum_probs=57.2

Q ss_pred             CCCccccccc-ccCCCCCCCceEEecCCcccccc--ccccceeeeeCCCCeEEecCCCCccccccccccCcch
Q psy15495         25 LYCPTMFDGW-SCWNATLAGETARTPCPNFIVGF--DSRRFALRTCLENGTWFQHPVTRKFWSNYTTCIDIED   94 (158)
Q Consensus        25 ~~C~~~wD~~-~CWp~t~~G~~v~~~CP~~~~~~--~~~~~a~R~C~~dG~W~~~p~t~~~wtnYt~C~~~~~   94 (158)
                      .+|+++||+| +|||+|++|++|++|||+||.++  ++.++|+|+|+.+|+|.       .|+||+.|....+
T Consensus        44 ~~C~~twD~i~~CWP~T~aG~~v~~pCP~~~~g~~~~~~~~a~R~C~~nG~W~-------~~sNYt~C~~~~~  109 (119)
T d1u34a_          44 TYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWA-------SRVNYSHCEPILD  109 (119)
T ss_dssp             SCCCCBCCSSSCCBCCCCTTCBCCCCSSCTTSSSCCCCCCCCCCBCCTTSCCC-------SCCCCCSSSCCSS
T ss_pred             CCCCCcCCCCcccCCCCCCCCEEEecCChhhccccccccceEEEecCCCccCC-------CcCCchhcccccc
Confidence            6999999999 89999999999999999999875  57899999999999995       6899999977643



>d2joda1 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-activating polypeptide type I receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u34a_ g.76.1.1 (A:) Corticotropin releasing factor receptor 2, CRFR-2beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2joda1 g.76.1.1 (A:17-122) Pituitary adenylate cyclase-activating polypeptide type I receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva2 g.18.1.1 (A:342-409) Complement C1S protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a2 g.18.1.1 (A:138-199) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ly2a2 g.18.1.1 (A:67-129) Complement receptor 2, cr2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a4 g.18.1.1 (A:9-76) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba4 g.18.1.1 (A:184-243) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1quba2 g.18.1.1 (A:63-120) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g40a4 g.18.1.1 (A:185-243) Complement control protein {Vaccinia virus [TaxId: 10245]} Back     information, alignment and structure
>d1quba3 g.18.1.1 (A:121-183) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ok5a3 g.18.1.1 (A:77-137) Complement factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zjka2 g.18.1.1 (A:311-363) Complement C1R protease domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hfia_ g.18.1.1 (A:) Factor H, 15th and 16th modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2o39c1 g.18.1.1 (C:1-62) CD46 (membrane cofactor protein, MCP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3xa2 g.18.1.1 (A:366-440) Mannan-binding lectin serine protease 2 (MASP-2) domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ok3a1 g.18.1.1 (A:1-64) Complement decay-accelerating factor (Daf, CD55) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure