Diaphorina citri psyllid: psy15514


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MCWGDRLIKEGLCDRGSAPSVSAISRLLRGHEGDDTSSEKKLSDGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLFPHFLIIIEQQSSGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMRG
cccccHHHHcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHcccccccHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEEEccccccccc
*CWGDRLIKEGLCDRGSA**************************************************************FERTQYPDIYTREEL********************************************SAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMR*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCWGDRLIKEGLCDRGSAPSVSAISRLLRGHEGDDTSSEKKLSDGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLFPHFLIIIEQQSSGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMRG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048066 [BP]developmental pigmentationprobableGO:0032502, GO:0043473, GO:0008150, GO:0044699
GO:0001755 [BP]neural crest cell migrationprobableGO:0030154, GO:0048468, GO:0006928, GO:0051674, GO:0001667, GO:0007275, GO:0044699, GO:0014032, GO:0014033, GO:0014031, GO:0048864, GO:0048869, GO:0048513, GO:0016477, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0048731, GO:0060485, GO:0051179, GO:0040011, GO:0044707, GO:0048870, GO:0048856, GO:0008150
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0060025 [BP]regulation of synaptic activityprobableGO:0019226, GO:0035637, GO:0050803, GO:0050804, GO:0023052, GO:0023051, GO:0010646, GO:0050789, GO:0044699, GO:0044057, GO:0065007, GO:0065008, GO:0032501, GO:0050877, GO:0009987, GO:0050794, GO:0044763, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0031644, GO:0008150, GO:0051969
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityprobableGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0060594 [BP]mammary gland specificationprobableGO:0060592, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0060443, GO:0048513, GO:0022612, GO:0030879, GO:0048646, GO:0032502, GO:0009887, GO:0032501, GO:0044767, GO:0008150, GO:0003002, GO:0044707, GO:0010092, GO:0048856, GO:0048645, GO:0048731, GO:0048732
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007517 [BP]muscle organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0061061, GO:0048731, GO:0007275, GO:0044699
GO:0021527 [BP]spinal cord association neuron differentiationprobableGO:0021515, GO:0021516, GO:0021510, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0021953, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0030154, GO:0044763
GO:0001843 [BP]neural tube closureprobableGO:0032502, GO:0016331, GO:0035148, GO:0009790, GO:0072175, GO:0009792, GO:0021915, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048729, GO:0001841, GO:0060562, GO:0043009, GO:0048646, GO:0048598, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0060606, GO:0008150, GO:0035295, GO:0001838, GO:0014020, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048731
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0048663 [BP]neuron fate commitmentprobableGO:0032502, GO:0048699, GO:0045165, GO:0007399, GO:0030182, GO:0009987, GO:0048869, GO:0030154, GO:0032501, GO:0044763, GO:0048731, GO:0044707, GO:0008150, GO:0022008, GO:0007275, GO:0044699, GO:0048856

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FJL, chain A
Confidence level:very confident
Coverage over the Query: 131-186
View the alignment between query and template
View the model in PyMOL
Template: 1FJL, chain A
Confidence level:very confident
Coverage over the Query: 61-115
View the alignment between query and template
View the model in PyMOL
Template: 1IC8, chain A
Confidence level:confident
Coverage over the Query: 4-44,64-115
View the alignment between query and template
View the model in PyMOL