Psyllid ID: psy15514


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------
MCWGDRLIKEGLCDRGSAPSVSAISRLLRGHEGDDTSSEKKLSDGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLFPHFLIIIEQQSSGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMRG
cccccHHHHcccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccHHHHHHHHcccccccHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccEEEccccccccc
ccccHHHHHcccccccccccHHHHHHHcHHHHccHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHc
mcwgdrlikeglcdrgsapsvSAISRLLrghegddtssekklsdgegsdcdsepgiplkrkqrrsrttfSAQQLDELERAFErtqypdiytREELAQRTKLFPHFLIIIEqqssgegsdcdsepgiplkrkqrrsrttfSAQQLDELERAFErtqypdiytREELAQRTKLTEARIQTIFIVRKMRG
MCWGDRLIKeglcdrgsapsvSAISRllrghegddtssekklsdgegsdcdsepgiplkrkqrrsrttfsaqqldelerafertqypdiYTREELAQRTKLFPHFLIIIEqqssgegsdcdsepgiplkrkqrrsrttfsaqqldelerafertqypdiytreelaqrtklteariqTIFIVRKMRG
MCWGDRLIKEGLCDRGSAPSVSAISRLLRGHEGDDTSSEKKLSDGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLFPHFLIIIEQQSSGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMRG
******LI************************************************************************FERTQYPDIYTREELAQRTKLFPHFLIIIE*******************************************TQYPDIYTREELAQRTKLTEARIQTIFIV*****
*CWGDRLIKEGLCDRGSA*************************************************************************************************************************SAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMR*
MCWGDRLIKEGLCDRGSAPSVSAISRLLR************************PGIPLK**********SAQQLDELERAFERTQYPDIYTREELAQRTKLFPHFLIIIEQQ***********PGIPLK**********SAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMRG
MCWGDRLIKEGLCDRGSAPSVSAISRLLRGHEGDDTSS************************RRSRTTFSAQQLDELERAFERTQYPDIYTREEL***************************************SRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRK***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCWGDRLIKEGLCDRGSAPSVSAISRLLRGHEGDDTSSEKKLSDGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLFPHFLIIIEQQSSGEGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query187 2.2.26 [Sep-21-2011]
P06601 613 Segmentation protein pair yes N/A 0.737 0.225 0.459 7e-32
Q645N4 484 Paired box protein Pax-3- N/A N/A 0.748 0.289 0.456 2e-31
Q0IH87 483 Paired box protein Pax-3- N/A N/A 0.748 0.289 0.456 5e-31
P24610 479 Paired box protein Pax-3 yes N/A 0.743 0.290 0.456 6e-31
P23760 479 Paired box protein Pax-3 no N/A 0.743 0.290 0.456 8e-31
P47239 503 Paired box protein Pax-7 no N/A 0.705 0.262 0.475 8e-31
P23759 520 Paired box protein Pax-7 no N/A 0.518 0.186 0.549 9e-26
Q28DP6 461 Paired box protein Pax-3 no N/A 0.390 0.158 0.780 1e-25
P09083 449 Protein gooseberry-neuro no N/A 0.502 0.209 0.590 1e-24
P09082 427 Protein gooseberry OS=Dro no N/A 0.513 0.224 0.590 2e-22
>sp|P06601|PRD_DROME Segmentation protein paired OS=Drosophila melanogaster GN=prd PE=1 SV=1 Back     alignment and function desciption
 Score =  136 bits (343), Expect = 7e-32,   Method: Composition-based stats.
 Identities = 85/185 (45%), Positives = 101/185 (54%), Gaps = 47/185 (25%)

Query: 5   DRLIKEGLCDRGSAPSVSAISRLLRGHEG---DDTSSEKKLSDGEGSDCDSEPGIPLKRK 61
           ++LI+EG+CDR +APSVSAISRL+RG +    +D SS      G+G+   S  G  +   
Sbjct: 127 EKLIREGVCDRSTAPSVSAISRLVRGRDAPLDNDMSSASGSPAGDGTKASSSCGSDVSGG 186

Query: 62  QRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLFPHFLIIIEQQSSGEGSDCD 121
              +                                             + S  + SDC+
Sbjct: 187 HHNN--------------------------------------------GKPSDEDISDCE 202

Query: 122 SEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFI 181
           SEPGI LKRKQRR RTTFSA QLDELERAFERTQYPDIYTREELAQRT LTEARIQ  F 
Sbjct: 203 SEPGIALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFS 262

Query: 182 VRKMR 186
            R+ R
Sbjct: 263 NRRAR 267




Pair-rule protein expressed in a segmentally repeating pattern to define the polarity of embryonic segments. Capable of sequence-specific DNA-binding.
Drosophila melanogaster (taxid: 7227)
>sp|Q645N4|PAX3A_XENLA Paired box protein Pax-3-A OS=Xenopus laevis GN=pax3-a PE=2 SV=1 Back     alignment and function description
>sp|Q0IH87|PAX3B_XENLA Paired box protein Pax-3-B OS=Xenopus laevis GN=pax3-b PE=2 SV=2 Back     alignment and function description
>sp|P24610|PAX3_MOUSE Paired box protein Pax-3 OS=Mus musculus GN=Pax3 PE=1 SV=2 Back     alignment and function description
>sp|P23760|PAX3_HUMAN Paired box protein Pax-3 OS=Homo sapiens GN=PAX3 PE=1 SV=2 Back     alignment and function description
>sp|P47239|PAX7_MOUSE Paired box protein Pax-7 OS=Mus musculus GN=Pax7 PE=2 SV=2 Back     alignment and function description
>sp|P23759|PAX7_HUMAN Paired box protein Pax-7 OS=Homo sapiens GN=PAX7 PE=2 SV=3 Back     alignment and function description
>sp|Q28DP6|PAX3_XENTR Paired box protein Pax-3 OS=Xenopus tropicalis GN=pax3 PE=2 SV=2 Back     alignment and function description
>sp|P09083|GSBN_DROME Protein gooseberry-neuro OS=Drosophila melanogaster GN=gsb-n PE=1 SV=2 Back     alignment and function description
>sp|P09082|GSB_DROME Protein gooseberry OS=Drosophila melanogaster GN=gsb PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
328719097 574 PREDICTED: paired box protein Pax-3-B-li 0.513 0.167 0.868 6e-43
307180596 516 Segmentation protein paired [Camponotus 0.802 0.290 0.543 6e-38
328782878 531 PREDICTED: paired box protein Pax-3-B [A 0.502 0.177 0.83 1e-37
383854529 483 PREDICTED: paired box protein Pax-3-B-li 0.502 0.194 0.82 2e-37
350397864 522 PREDICTED: LOW QUALITY PROTEIN: protein 0.502 0.180 0.81 2e-36
340724544 502 PREDICTED: LOW QUALITY PROTEIN: segmenta 0.502 0.187 0.794 4e-36
270009304 447 paired [Tribolium castaneum] 0.502 0.210 0.795 1e-35
242007394 439 Paired box protein Pax-7, putative [Pedi 0.502 0.214 0.772 1e-35
307197090 481 Segmentation protein paired [Harpegnatho 0.518 0.201 0.731 7e-35
322794106 486 hypothetical protein SINV_02934 [Solenop 0.502 0.193 0.77 9e-35
>gi|328719097|ref|XP_001949018.2| PREDICTED: paired box protein Pax-3-B-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 86/99 (86%), Positives = 95/99 (95%), Gaps = 3/99 (3%)

Query: 6   RLIKEGLCDRGSAPSVSAISRLLRGHEGDDTSSEKKLSDG---EGSDCDSEPGIPLKRKQ 62
           RLI+EGLCDRGSAPS+SAISRLLRGH+GDD++SEKK+SDG   +GSDCDSEPGIPLKRKQ
Sbjct: 134 RLIREGLCDRGSAPSISAISRLLRGHDGDDSASEKKVSDGKTSDGSDCDSEPGIPLKRKQ 193

Query: 63  RRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKL 101
           RRSRTTF+A QLDELE+AFERTQYPDIYTREELAQRTKL
Sbjct: 194 RRSRTTFTALQLDELEKAFERTQYPDIYTREELAQRTKL 232




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307180596|gb|EFN68551.1| Segmentation protein paired [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328782878|ref|XP_003250208.1| PREDICTED: paired box protein Pax-3-B [Apis mellifera] Back     alignment and taxonomy information
>gi|383854529|ref|XP_003702773.1| PREDICTED: paired box protein Pax-3-B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350397864|ref|XP_003485014.1| PREDICTED: LOW QUALITY PROTEIN: protein gooseberry-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340724544|ref|XP_003400641.1| PREDICTED: LOW QUALITY PROTEIN: segmentation protein paired-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|270009304|gb|EFA05752.1| paired [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242007394|ref|XP_002424525.1| Paired box protein Pax-7, putative [Pediculus humanus corporis] gi|212507958|gb|EEB11787.1| Paired box protein Pax-7, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307197090|gb|EFN78458.1| Segmentation protein paired [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322794106|gb|EFZ17315.1| hypothetical protein SINV_02934 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query187
ZFIN|ZDB-GENE-980526-52 509 pax3a "paired box gene 3a" [Da 0.529 0.194 0.617 8.6e-35
FB|FBgn0003145 613 prd "paired" [Drosophila melan 0.368 0.112 0.840 1.5e-34
UNIPROTKB|P23760 479 PAX3 "Paired box protein Pax-3 0.508 0.198 0.64 1.2e-25
MGI|MGI:97487 479 Pax3 "paired box gene 3" [Mus 0.508 0.198 0.64 1.2e-25
UNIPROTKB|F1MTX0 484 PAX3 "Uncharacterized protein" 0.508 0.196 0.64 1.3e-25
UNIPROTKB|E2QX72 485 PAX3 "Uncharacterized protein" 0.508 0.195 0.64 1.3e-25
UNIPROTKB|F1LMV3 487 Pax3 "Protein Pax3" [Rattus no 0.508 0.195 0.64 1.4e-25
UNIPROTKB|I3LAG7 483 PAX3 "Uncharacterized protein" 0.502 0.194 0.623 2.8e-25
ZFIN|ZDB-GENE-080917-53 480 pax3b "paired box gene 3b" [Da 0.737 0.287 0.496 6e-25
UNIPROTKB|Q28DP6 461 pax3 "Paired box protein Pax-3 0.390 0.158 0.780 6.1e-25
ZFIN|ZDB-GENE-980526-52 pax3a "paired box gene 3a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 299 (110.3 bits), Expect = 8.6e-35, Sum P(2) = 8.6e-35
 Identities = 63/102 (61%), Positives = 77/102 (75%)

Query:    88 DIYTREELAQRTKLFPHFL--IIIEQQS-SGEGSDCDSEPGIPLKRKQRRSRTTFSAQQL 144
             D   + E+ +  +   H +  I+ ++ S S EGSD DSEPG+PLKRKQRRSRTTF+A+QL
Sbjct:   173 DEVEKREIEENERRAKHSIDGILGDRSSHSDEGSDVDSEPGLPLKRKQRRSRTTFTAEQL 232

Query:   145 DELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMR 186
             +ELERAFERT YPDIYTREELAQR KLTEAR+Q  F  R+ R
Sbjct:   233 EELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRAR 274


GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA;IDA
GO:0001755 "neural crest cell migration" evidence=IMP
GO:0048066 "developmental pigmentation" evidence=IMP
GO:0050936 "xanthophore differentiation" evidence=IMP
GO:0048484 "enteric nervous system development" evidence=IMP
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
FB|FBgn0003145 prd "paired" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P23760 PAX3 "Paired box protein Pax-3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:97487 Pax3 "paired box gene 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTX0 PAX3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QX72 PAX3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMV3 Pax3 "Protein Pax3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3LAG7 PAX3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080917-53 pax3b "paired box gene 3b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q28DP6 pax3 "Paired box protein Pax-3" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-16
smart0038957 smart00389, HOX, Homeodomain 2e-14
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 5e-14
pfam0004657 pfam00046, Homeobox, Homeobox domain 4e-12
smart0038957 smart00389, HOX, Homeodomain 3e-10
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 7e-10
cd00131128 cd00131, PAX, Paired Box domain 2e-06
smart00351125 smart00351, PAX, Paired Box domain 5e-06
pfam00292125 pfam00292, PAX, 'Paired box' domain 1e-05
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 5e-04
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 0.004
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
 Score = 68.7 bits (169), Expect = 3e-16
 Identities = 25/54 (46%), Positives = 38/54 (70%)

Query: 133 RRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMR 186
           RR RTTF+ +QL+ELE+ FE+ +YP    REELA++  LTE +++  F  R+ +
Sbjct: 1   RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVKVWFQNRRAK 54


Length = 57

>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|238076 cd00131, PAX, Paired Box domain Back     alignment and domain information
>gnl|CDD|128645 smart00351, PAX, Paired Box domain Back     alignment and domain information
>gnl|CDD|109353 pfam00292, PAX, 'Paired box' domain Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 187
KOG0484|consensus125 99.86
KOG0849|consensus 354 99.84
KOG0490|consensus235 99.76
KOG0843|consensus197 99.75
KOG2251|consensus 228 99.74
KOG0850|consensus245 99.72
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.72
KOG0488|consensus309 99.72
KOG0484|consensus125 99.71
KOG0842|consensus307 99.71
KOG0489|consensus261 99.7
KOG0494|consensus 332 99.69
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.69
KOG0492|consensus246 99.67
KOG0487|consensus308 99.66
KOG0485|consensus 268 99.65
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.62
KOG0493|consensus342 99.62
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.57
KOG0848|consensus317 99.54
KOG0491|consensus194 99.53
KOG0486|consensus 351 99.52
KOG3862|consensus327 99.49
KOG3802|consensus398 99.49
KOG0844|consensus 408 99.49
KOG3517|consensus334 99.47
KOG2251|consensus228 99.46
COG5576156 Homeodomain-containing transcription factor [Trans 99.45
KOG0494|consensus332 99.44
KOG0850|consensus245 99.44
KOG0842|consensus307 99.43
KOG0483|consensus198 99.41
KOG0843|consensus197 99.41
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.39
KOG4577|consensus 383 99.37
KOG0488|consensus309 99.36
KOG0490|consensus 235 99.31
KOG0489|consensus261 99.3
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.24
KOG0485|consensus268 99.24
KOG0847|consensus288 99.23
KOG0492|consensus246 99.23
KOG0486|consensus 351 99.16
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.09
KOG0493|consensus342 99.06
cd0008659 homeodomain Homeodomain; DNA binding domains invol 98.99
COG5576156 Homeodomain-containing transcription factor [Trans 98.97
KOG0844|consensus 408 98.95
KOG0487|consensus308 98.95
KOG0848|consensus317 98.89
KOG0849|consensus354 98.88
KOG0775|consensus304 98.85
KOG0491|consensus194 98.82
KOG1168|consensus385 98.74
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.72
KOG2252|consensus558 98.54
KOG0847|consensus288 98.48
KOG0483|consensus198 98.39
KOG4577|consensus383 98.36
KOG3802|consensus398 98.26
KOG0774|consensus334 98.19
KOG1146|consensus 1406 97.8
KOG2252|consensus558 97.64
KOG3623|consensus 1007 97.58
KOG0775|consensus304 97.45
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.42
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 97.34
KOG0773|consensus342 96.63
KOG1168|consensus385 96.53
KOG0774|consensus334 96.1
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 95.8
KOG3623|consensus 1007 95.57
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 95.2
KOG1146|consensus 1406 95.1
PF0496753 HTH_10: HTH DNA binding domain; InterPro: IPR00705 93.58
PF13551112 HTH_29: Winged helix-turn helix 87.57
PF0152776 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transp 85.68
COG3413215 Predicted DNA binding protein [General function pr 83.97
KOG0773|consensus342 82.69
PF1066860 Phage_terminase: Phage terminase small subunit; In 82.54
>KOG0484|consensus Back     alignment and domain information
Probab=99.86  E-value=1.2e-22  Score=129.58  Aligned_cols=63  Identities=59%  Similarity=0.874  Sum_probs=59.3

Q ss_pred             CCCcccccccccCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHcCCChhhhhhhhcccCCC
Q psy15514        124 PGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMR  186 (187)
Q Consensus       124 ~~~~~~~~~~r~r~~~t~~q~~~Le~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k  186 (187)
                      .+...++|++|.||+||..||.+||++|...+||++..|++||.+++|++.+|||||||||+|
T Consensus         9 ~~l~ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAK   71 (125)
T KOG0484|consen    9 LGLTEKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAK   71 (125)
T ss_pred             CChhHHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHH
Confidence            344567899999999999999999999999999999999999999999999999999999987



>KOG0849|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>KOG3862|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG3517|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF04967 HTH_10: HTH DNA binding domain; InterPro: IPR007050 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif Back     alignment and domain information
>PF13551 HTH_29: Winged helix-turn helix Back     alignment and domain information
>PF01527 HTH_Tnp_1: Transposase; InterPro: IPR002514 Transposase proteins are necessary for efficient DNA transposition Back     alignment and domain information
>COG3413 Predicted DNA binding protein [General function prediction only] Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF10668 Phage_terminase: Phage terminase small subunit; InterPro: IPR018925 This entry describes the terminase small subunit from Enterococcus phage phiFL1A, related proteins in other bacteriophage, and prophage regions of bacterial genomes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 3e-27
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 2e-18
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 2e-14
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 1e-13
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 6e-12
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 3e-11
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 2e-10
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 3e-10
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 1e-09
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 3e-09
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 2e-07
1pdn_C128 Crystal Structure Of A Paired Domain-Dna Complex At 3e-05
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 2e-04
2kt0_A84 Solution Structure Of Human Stem Cell Transcription 5e-04
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 6e-04
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure

Iteration: 1

Score = 117 bits (294), Expect = 3e-27, Method: Compositional matrix adjust. Identities = 59/69 (85%), Positives = 61/69 (88%) Query: 118 SDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQ 177 SDC+SEPGI LKRKQRRSRTTFSA QLDELERAFERTQYPDIYTREELAQRT LTEARIQ Sbjct: 4 SDCESEPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQ 63 Query: 178 TIFIVRKMR 186 F R+ R Sbjct: 64 VWFQNRRAR 72
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|1PDN|C Chain C, Crystal Structure Of A Paired Domain-Dna Complex At 2.5 Angstroms Resolution Reveals Structural Basis For Pax Developmental Mutations Length = 128 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2KT0|A Chain A, Solution Structure Of Human Stem Cell Transcription Factor Nanog Homeodomain Fragment Length = 84 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query187
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 5e-31
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 3e-26
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-25
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 6e-21
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 2e-25
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 8e-21
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 3e-25
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-20
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 8e-25
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 5e-20
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 5e-24
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 1e-19
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 7e-23
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 5e-18
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-22
3a02_A60 Homeobox protein aristaless; homeodomain, developm 1e-17
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-22
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-18
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-21
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 2e-17
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 9e-20
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 5e-16
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 8e-19
1uhs_A72 HOP, homeodomain only protein; structural genomics 4e-18
1uhs_A72 HOP, homeodomain only protein; structural genomics 1e-13
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-16
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-13
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 2e-16
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 3e-16
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 5e-15
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-16
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 8e-12
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 5e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 3e-11
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-14
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 2e-11
3d1n_I151 POU domain, class 6, transcription factor 1; prote 5e-13
3d1n_I151 POU domain, class 6, transcription factor 1; prote 8e-11
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 4e-12
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 2e-11
1lfb_A99 Liver transcription factor (LFB1); transcription r 8e-12
1lfb_A99 Liver transcription factor (LFB1); transcription r 1e-11
2xsd_C164 POU domain, class 3, transcription factor 1; trans 3e-11
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-09
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 4e-11
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 3e-10
1e3o_C160 Octamer-binding transcription factor 1; transcript 7e-11
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-10
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 6e-08
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-10
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 3e-07
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 3e-10
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 2e-07
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-10
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 6e-08
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 4e-10
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 5e-07
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 6e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-07
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 1e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 3e-07
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 1e-09
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 2e-07
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-09
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 5e-07
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-09
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 8e-07
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-09
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 5e-07
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 3e-09
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 1e-06
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 5e-09
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 8e-07
3a01_A93 Homeodomain-containing protein; homeodomain, prote 5e-09
3a01_A93 Homeodomain-containing protein; homeodomain, prote 4e-06
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-08
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 1e-05
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 6e-08
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 7e-05
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 2e-07
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-05
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-07
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 2e-04
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 2e-07
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 1e-04
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-06
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 6e-04
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 1e-06
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 3e-06
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 1e-04
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 5e-06
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-05
1pdn_C128 Protein (PRD paired); protein-DNA complex, double 1e-05
2k27_A159 Paired box protein PAX-8; paired domain, solution 4e-05
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 4e-05
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 6e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 7e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 8e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 1e-04
1k78_A149 Paired box protein PAX5; paired domain, ETS domain 2e-04
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 5e-04
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
 Score =  107 bits (268), Expect = 5e-31
 Identities = 57/65 (87%), Positives = 59/65 (90%)

Query: 116 EGSDCDSEPGIPLKRKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEAR 175
           + SDC+SEPGI LKRKQRRSRTTFSA QLDELERAFERTQYPDIYTREELAQRT LTEAR
Sbjct: 2   DISDCESEPGIALKRKQRRSRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEAR 61

Query: 176 IQTIF 180
           IQ  F
Sbjct: 62  IQVWF 66


>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1pdn_C Protein (PRD paired); protein-DNA complex, double helix, PAX, paired domain, DNA-binding protein, gene regulation/DNA complex; HET: DNA; 2.50A {Drosophila melanogaster} SCOP: a.4.1.5 Length = 128 Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Length = 159 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1k78_A Paired box protein PAX5; paired domain, ETS domain, transcription factor, transcription/DNA complex; 2.25A {Homo sapiens} SCOP: a.4.1.5 a.4.1.5 PDB: 1mdm_A 6pax_A Length = 149 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.85
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.85
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.83
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.83
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.83
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.83
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.82
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.82
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.82
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.81
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.81
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.81
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.81
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.81
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.81
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.81
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.8
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.8
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.8
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.8
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.8
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.8
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.8
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.8
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.8
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.8
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.8
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.79
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.79
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.79
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.79
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.79
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.79
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.79
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.79
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.78
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.78
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.78
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.78
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.78
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.78
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.77
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.77
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.77
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.77
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.76
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.76
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.76
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.75
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.75
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.75
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.74
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.74
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.74
2e19_A64 Transcription factor 8; homeobox domain, structura 99.74
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.74
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.74
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.73
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.73
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.73
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.73
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.73
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.72
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.72
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.72
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.72
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.71
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.71
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.7
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.69
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.68
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.67
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.62
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.6
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.59
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.58
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.57
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.57
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.57
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.56
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.56
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.55
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.55
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.54
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.53
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.51
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.51
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.51
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.51
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.51
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.51
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.5
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.5
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.49
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.49
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.49
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.49
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.48
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.48
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.48
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.48
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.48
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.48
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.47
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.47
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.47
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.46
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.46
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.46
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.46
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.45
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.44
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.44
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.44
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.44
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.42
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.42
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.41
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.4
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.4
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.4
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.38
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.38
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.38
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.38
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.37
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.37
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.37
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.35
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.34
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.34
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.33
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.3
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.3
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.3
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.3
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.3
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.29
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.29
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.28
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.28
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.28
2e19_A64 Transcription factor 8; homeobox domain, structura 99.27
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.26
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.23
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.23
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.22
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.22
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.18
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.16
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.04
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 98.91
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 98.63
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 98.53
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.37
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 96.48
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 93.27
2glo_A59 Brinker CG9653-PA; protein-DNA complex, helix-turn 89.09
2elh_A87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 86.42
2k27_A159 Paired box protein PAX-8; paired domain, solution 85.59
1tc3_C51 Protein (TC3 transposase); DNA binding, helix-turn 85.2
1hlv_A131 CENP-B, major centromere autoantigen B; helix-turn 83.65
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
Probab=99.85  E-value=1.6e-21  Score=122.62  Aligned_cols=59  Identities=24%  Similarity=0.262  Sum_probs=55.8

Q ss_pred             cccccccCCCCCHHHHHHHHHHhhh----cCCCCHHHHHHHHHHcCCChhhhhhhhcccCCCC
Q psy15514        129 KRKQRRSRTTFSAQQLDELERAFER----TQYPDIYTREELAQRTKLTEARIQTIFIVRKMRG  187 (187)
Q Consensus       129 ~~~~~r~r~~~t~~q~~~Le~~f~~----~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k~  187 (187)
                      ..+.+|.||.||.+|+.+||..|+.    ++||+..++++||..|||++.+|+|||||||+|.
T Consensus        14 ~~~~rR~Rt~ft~~Ql~~Le~~f~~~~~~~~yp~~~~r~~La~~lgL~~~~VkvWFqNrRaK~   76 (80)
T 1wh5_A           14 GGIRKRHRTKFTAEQKERMLALAERIGWRIQRQDDEVIQRFCQETGVPRQVLKVWLHNNKHSG   76 (80)
T ss_dssp             CCCSCCCSCCCCHHHHHHHHHHHHHHTSCCCTTTHHHHHHHHHHSCCCHHHHHHHHHHHSSSS
T ss_pred             CCCCCCCCccCCHHHHHHHHHHHHhccCcCCCcCHHHHHHHHHHhCCCcccccCCccccCcCC
Confidence            3567889999999999999999999    9999999999999999999999999999999983



>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2glo_A Brinker CG9653-PA; protein-DNA complex, helix-turn-helix motif, transcription/DNA complex; NMR {Drosophila melanogaster} Back     alignment and structure
>2elh_A CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure
>2k27_A Paired box protein PAX-8; paired domain, solution structure, triple frequency, 3D NMR, induced FIT, alternative splicing, developmental protein; NMR {Homo sapiens} Back     alignment and structure
>1tc3_C Protein (TC3 transposase); DNA binding, helix-turn-helix, TC1/mariner family, complex (transposase/DNA), DNA binding protein/DNA complex; HET: DNA; 2.45A {Caenorhabditis elegans} SCOP: a.4.1.2 Back     alignment and structure
>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 187
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-14
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-10
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 1e-13
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 4e-09
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 3e-13
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-09
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 4e-13
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-08
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 8e-13
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 2e-08
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 8e-13
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 4e-08
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-12
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 1e-08
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 2e-12
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 6e-10
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-12
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 8e-08
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 7e-12
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-07
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-11
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 3e-07
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 2e-11
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 3e-07
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 3e-11
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 4e-07
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 4e-11
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 6e-10
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-11
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 1e-07
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 5e-11
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 6e-08
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 8e-11
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-07
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-10
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 3e-07
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 1e-10
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 7e-06
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 3e-10
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 2e-06
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 3e-10
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 5e-06
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-10
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 3e-06
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5e-10
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-06
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 8e-10
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 2e-05
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 1e-09
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-06
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 3e-09
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 5e-05
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 4e-09
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 2e-05
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 6e-09
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 1e-04
d1k78a261 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [Ta 3e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 4e-08
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-04
d6paxa265 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [Ta 8e-08
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 5e-07
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 3e-06
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 2e-05
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 4e-04
d1pdnc_123 a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Dros 8e-04
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 63.3 bits (154), Expect = 2e-14
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 130 RKQRRSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMR 186
           R  R+ R  ++  Q  ELE+ F    Y     R E+A+   LTE +++  F  R+M+
Sbjct: 11  RSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMK 67


>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1k78a2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1pdnc_ a.4.1.5 (C:) Paired protein (prd) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query187
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.88
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.87
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.86
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.86
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.85
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.85
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.85
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.85
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.85
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.84
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.83
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.83
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.82
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.82
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.82
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.82
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.82
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.82
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.81
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.81
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.8
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.78
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.78
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.77
d1k78a261 Pax-5 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.73
d6paxa265 Pax-6 {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.71
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.7
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.7
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.69
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.65
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.65
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.64
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.63
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.63
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.62
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.61
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.6
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.59
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.58
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.58
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.57
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.57
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.57
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.56
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.56
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.56
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.54
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.53
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.52
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.5
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.49
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.48
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.46
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.45
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.43
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.38
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.26
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.25
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.22
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.13
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.07
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.07
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.01
d1ijwc_47 HIN recombinase (DNA-binding domain) {Synthetic} 93.54
d1hlva166 DNA-binding domain of centromere binding protein B 92.94
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Engrailed Homeodomain
species: Drosophila melanogaster [TaxId: 7227]
Probab=99.88  E-value=8.1e-24  Score=121.01  Aligned_cols=53  Identities=34%  Similarity=0.543  Sum_probs=51.5

Q ss_pred             ccCCCCCHHHHHHHHHHhhhcCCCCHHHHHHHHHHcCCChhhhhhhhcccCCC
Q psy15514        134 RSRTTFSAQQLDELERAFERTQYPDIYTREELAQRTKLTEARIQTIFIVRKMR  186 (187)
Q Consensus       134 r~r~~~t~~q~~~Le~~f~~~~~p~~~~~~~la~~~~l~~~~v~~WF~nrR~k  186 (187)
                      |.|+.||++|+..||..|+.++||+..++.+||..+||++.+|++||||||+|
T Consensus         1 R~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~lgL~~~qV~vWFqNrRaK   53 (53)
T d1p7ia_           1 RPRTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFQNARAK   53 (53)
T ss_dssp             CCCCCCCHHHHHHHHHHHHHCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHC
T ss_pred             CCCccCCHHHHHHHHHHHHHCCCCCHHHHHHHHHHhCCChHHhhhcccccCCC
Confidence            46899999999999999999999999999999999999999999999999987



>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k78a2 a.4.1.5 (A:82-142) Pax-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6paxa2 a.4.1.5 (A:69-133) Pax-6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ijwc_ a.4.1.2 (C:) HIN recombinase (DNA-binding domain) {Synthetic} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure