Diaphorina citri psyllid: psy15518


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MTLVSVVFQVLSLGADVLPEYKLQTPRIHKWTILHYSPFKAVWDWLILILVVYTAIFTPYVAAFLLNEPDFTNRTRNIRRYSDPIVFVDLIVDVTFIVDIAINFRTTYVNANDEVVSNPGLIALHYLRGWFIIDLVAAIPFDLLIFGSETEETLDSRELPLSMSIEMHFKLLTSVMTKWIGLKRLTLPFLYDMLY
ccccHHHHHHHcccccccccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccccccccEEEEEcccEEEEEEEEEEEEEEEEECcccCEECcHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
***VSVVFQVLSLGADVLPEYKLQTPRIHKWTILHYSPFKAVWDWLILILVVYTAIFTPYVAAFLLNEPDFTNRTRNIRRYSDPIVFVDLIVDVTFIVDIAINFRTTYVNANDEVVSNPGLIALHYLRGWFIIDLVAAIPFDLLIFGSETEETLDSRELPLSMSIEMHFKLLTSVMTKWIGLKRLTLPFLYDMLY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTLVSVVFQVLSLGADVLPEYKLQTPRIHKWTILHYSPFKAVWDWLILILVVYTAIFTPYVAAFLLNEPDFTNRTRNIRRYSDPIVFVDLIVDVTFIVDIAINFRTTYVNANDEVVSNPGLIALHYLRGWFIIDLVAAIPFDLLIFGSETEETLDSRELPLSMSIEMHFKLLTSVMTKWIGLKRLTLPFLYDMLY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Potassium voltage-gated channel subfamily H member 2 Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr).confidentQ9TSZ3
Potassium voltage-gated channel subfamily H member 2 Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr).confidentO08962
Potassium voltage-gated channel subfamily H member 2 Pore-forming (alpha) subunit of voltage-gated inwardly rectifying potassium channel. Channel properties are modulated by cAMP and subunit assembly. Mediates the rapidly activating component of the delayed rectifying potassium current in heart (IKr).confidentQ8WNY2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051291 [BP]protein heterooligomerizationconfidentGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0006813 [BP]potassium ion transportconfidentGO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0005249 [MF]voltage-gated potassium channel activityconfidentGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0022839, GO:0022838, GO:0015079
GO:0005886 [CC]plasma membraneconfidentGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0060307 [BP]regulation of ventricular cardiac muscle cell membrane repolarizationprobableGO:0042391, GO:0051049, GO:0050801, GO:0055082, GO:0060306, GO:0032844, GO:0042592, GO:0001508, GO:0034765, GO:0050789, GO:0034762, GO:0051234, GO:0086001, GO:0086009, GO:0051179, GO:0065007, GO:0043269, GO:0065008, GO:0019725, GO:0006810, GO:0006811, GO:0009987, GO:0006873, GO:0050794, GO:0034220, GO:0044765, GO:0008150, GO:0086013, GO:0086011, GO:0032879, GO:0055085, GO:0044699, GO:0086036, GO:0048878, GO:2000021, GO:0044763
GO:0005242 [MF]inward rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015276, GO:0022857, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0015077, GO:0015267, GO:0022836, GO:0005249, GO:0022834, GO:0022839, GO:0022838, GO:0015079
GO:0071805 [BP]potassium ion transmembrane transportprobableGO:0006810, GO:0071804, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0015672, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0030001, GO:0051179, GO:0051234, GO:0055085, GO:0044699
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0086091 [BP]regulation of heart rate by cardiac conductionprobableGO:0044700, GO:0032501, GO:0061337, GO:0035637, GO:0008016, GO:0050789, GO:0008150, GO:0002027, GO:0044057, GO:0065007, GO:0051239, GO:0023052, GO:0065008, GO:0044707, GO:0044699
GO:0007623 [BP]circadian rhythmprobableGO:0048511, GO:0008150
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0008076 [CC]voltage-gated potassium channel complexprobableGO:0043234, GO:0032991, GO:0044459, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0034702, GO:0034705, GO:0071944, GO:0034703, GO:0005887, GO:0005886, GO:0044425, GO:0031226, GO:0031224
GO:0000155 [MF]phosphorelay sensor kinase activityprobableGO:0038023, GO:0004673, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016775, GO:0060089, GO:0016740, GO:0003674, GO:0004872, GO:0004871, GO:0004672
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0005251 [MF]delayed rectifier potassium channel activityprobableGO:0005267, GO:0005261, GO:0003674, GO:0015077, GO:0022843, GO:0022803, GO:0046873, GO:0005215, GO:0005216, GO:0008324, GO:0022891, GO:0022890, GO:0022892, GO:0005244, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0022836, GO:0005249, GO:0022839, GO:0022838, GO:0015079
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BEH, chain A
Confidence level:probable
Coverage over the Query: 37-70,81-113,124-170
View the alignment between query and template
View the model in PyMOL