Diaphorina citri psyllid: psy1551

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190

MKEMETAPVIPESEVWDVWIPPQRQFSLSRICCEEEGTEENKDEKPVDPAKDRRNPVPVEISIRYLASEAYQKCYGDEPVWKYYRRNHKGMFAPKKTRKTCIRSGIIATGNPCPICRDEYLIIHPYNIKLLEQFISPVNGEILSYMKTGVCQKQHLKLLVAITQAKNKGLITFDLPFREYNYKDYFPTSV

ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcHHHHHHHHcccccHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccEEcccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccc

**********PESEVWDVWIPPQRQFSLSRICC********************RNPVPVEISIRYLASEAYQKCYGDEPVWKYYRRNHKGMFAPKKTRKTCIRSGIIATGNPCPICRDEYLIIHPYNIKLLEQFISPVNGEILSYMKTGVCQKQHLKLLVAITQAKNKGLITFDLPFREYNYKDYFP***

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKEMETAPVIPESEVWDVWIPPQRQFSLSRICCEEEGTEENKDEKPVDPAKDRRNPVPVEISIRYLASEAYQKCYGDEPVWKYYRRNHKGMFAPKKTRKTCIRSGIIATGNPCPICRDEYLIIHPYNIKLLEQFISPVNGEILSYMKTGVCQKQHLKLLVAITQAKNKGLITFDLPFREYNYKDYFPTSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
28S ribosomal protein S18b, mitochondrial		confident	Q767K8

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBN, chain R
Confidence level:confident
Coverage over the Query: 118-178
View the alignment between query and template
View the model in PyMOL