Diaphorina citri psyllid: psy15525


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MAHQFFKAIFKFPSIKAEEEELNTAQMAQQFFKAIFKFPSIKAEEEELVDPQVTLREKCSEAHCTKYLDKLQQCNDRVNSKQNTTESCYEELIDYAHCVDHCVAHDIHKYLK
cHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHcccHcHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcHHHHHHccc
***QFFKAIFKFPSIKAEEEELNTAQMAQQFFKAIFKFPSIKAEEEELVDPQVTLREKCSEAHCTKYLDKLQQCNDRVNSKQNTTESCYEELIDYAHCVDHCVAHDIHKYLK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHQFFKAIFKFPSIKAEEEELNTAQMAQQFFKAIFKFPSIKAEEEELVDPQVTLREKCSEAHCTKYLDKLQQCNDRVNSKQNTTESCYEELIDYAHCVDHCVAHDIHKYLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005750 [CC]mitochondrial respiratory chain complex IIIprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0032991, GO:0043231, GO:0045275, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0051291 [BP]protein heterooligomerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0032403 [MF]protein complex bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0006122 [BP]mitochondrial electron transport, ubiquinol to cytochrome cprobableGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0008121 [MF]ubiquinol-cytochrome-c reductase activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0003674, GO:0016679, GO:0015078, GO:0016681, GO:0016491

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3TGU, chain H
Confidence level:very confident
Coverage over the Query: 44-112
View the alignment between query and template
View the model in PyMOL