Diaphorina citri psyllid: psy15533

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------

MKKKISASPFLFCLLNWNEFFLFPISLLCFSVQTTGLGGMKPNTVILGWPYSWRQSDDLRTWEVFLNTVRVVSAAKMALLVPKGINFFPDTSVKIVGTIDVWWIVHDGGLLMLLPFLLRQHRTWKNCKLRIFTVAQMEDNSIQMKKDLKTFLYHLRIEAEVEVVEMTNNDISAYTYERTLMMEQRNQMLRELRLNKKESLGMVQAIVDQHHDTNKGVTKSQTKTRMNPEEIDEGNVRRMHTAVKLNEVIVNKSHEAQLVILNLPGPPKETNIERESNYMEFLEVLTEGLERVLMVREEKWTSEEGKSSLFPKGNSIVGTIDVWWIVHDGGLLMLLPFLLRQHRTWKNCKLRIFTVAQMEDNSIQMKKDLKTFLYHLRIEAEVEVVEM

cccccccccccEEEEEEccccHHHHHHHHHHHHHcccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcccHHHHHHHHHHcccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEccccccccccccccccccccccHHHHHHHHccHHHHHHHHHHHHcccccccHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEcccHHHHHHHHHHcccccccccEEEEEEEccccHHHHHHHHHHHHHHHcccccEEEEEEc

*******SPFLFCLLNWNEFFLFPISLLCFSVQTTGLGGMKPNTVILGWPYSWRQSDDLRTWEVFLNTVRVVSAAKMALLVPKGINFFPDTSVKIVGTIDVWWIVHDGGLLMLLPFLLRQHRTWKNCKLRIFTVAQMEDNSIQMKKDLKTFLYHLRIEAEVEVVEMTNNDISAYTYERTLMMEQRNQMLRELRLNKKESLGMVQAIVDQHHD***********************VR**HTAVKLNEVIVNKSHEAQLVILNLPGPPKETNIERESNYMEFLEVLTEGLERVLMVREEKWTSEEGKSSLFPKGNSIVGTIDVWWIVHDGGLLMLLPFLLRQHRTWKNCKLRIFTVAQMEDNSIQMKKDLKTFLYHLRIEAEVEVVEM

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Solute carrier family 12 member 4	Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl(-) exit in NaCl absorbing epithelia.	confident	Q9JIS8
Solute carrier family 12 member 4	Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl(-) exit in NaCl absorbing epithelia.	confident	Q63632
Solute carrier family 12 member 4	Mediates electroneutral potassium-chloride cotransport when activated by cell swelling. May contribute to cell volume homeostasis in single cells. May be involved in the regulation of basolateral Cl(-) exit in NaCl absorbing epithelia (By similarity). Isoform 4 has no transport activity.	confident	Q9UP95

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0051452 [BP]	intracellular pH reduction	probable	GO:0019725, GO:0042592, GO:0044699, GO:0045851, GO:0008150, GO:0006885, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0055080, GO:0030004, GO:0044763, GO:0055067, GO:0030003, GO:0051453, GO:0065007, GO:0055082, GO:0065008, GO:0030641
GO:0006884 [BP]	cell volume homeostasis	probable	GO:0019725, GO:0009987, GO:0042592, GO:0065007, GO:0044763, GO:0008150, GO:0065008, GO:0044699
GO:0006813 [BP]	potassium ion transport	probable	GO:0006812, GO:0006811, GO:0006810, GO:0051179, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0015672, GO:0044699
GO:0043204 [CC]	perikaryon	probable	GO:0044464, GO:0044297, GO:0005623, GO:0005575, GO:0097458, GO:0043025
GO:0015293 [MF]	symporter activity	probable	GO:0005215, GO:0022857, GO:0015291, GO:0003674, GO:0022804
GO:0008324 [MF]	cation transmembrane transporter activity	probable	GO:0022891, GO:0022892, GO:0005215, GO:0015075, GO:0022857, GO:0003674
GO:0055085 [BP]	transmembrane transport	probable	GO:0006810, GO:0009987, GO:0044765, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699
GO:0032590 [CC]	dendrite membrane	probable	GO:0016020, GO:0031256, GO:0044463, GO:0031253, GO:0031252, GO:0005623, GO:0044464, GO:0005575, GO:0097458, GO:0032589, GO:0071944, GO:0043005, GO:0005886, GO:0044425, GO:0042995, GO:0044459
GO:0051739 [MF]	ammonia transmembrane transporter activity	probable	GO:0022891, GO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0015696 [BP]	ammonium transport	probable	GO:0006812, GO:0006811, GO:0006810, GO:0044765, GO:0051179, GO:0071705, GO:0006820, GO:0008150, GO:0015698, GO:0051234, GO:0015672, GO:0044699
GO:0009628 [BP]	response to abiotic stimulus	probable	GO:0050896, GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G40, chain A
Confidence level:very confident
Coverage over the Query: 111-195,228-230,256-385
View the alignment between query and template
View the model in PyMOL

Template: 3G40, chain A
Confidence level:very confident
Coverage over the Query: 13-164
View the alignment between query and template
View the model in PyMOL