Diaphorina citri psyllid: psy15550


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MPQCPRFTHEDIKAQRYLLNGIEQVIALHKEKLLSMVPGILKLFYDYDILEEKVLLEWAEKTSKKYVSKELSAEIRSRAEPFIKWLREAEEEDSDSEESDDDLPNLGALTFGKVVHAELLDFKYN
cccccccccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHEEHHHHHHHcccccc
MPQCPRFTHEDIKAQRYLLNGIEQVIALHKEKLLSMVPGILKLFYDYDILEEKVLLEWAEKTSKKYVS********SRAEPFIKWL*******************LGALTFGKVVHAELLDFKY*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQCPRFTHEDIKAQRYLLNGIEQVIALHKEKLLSMVPGILKLFYDYDILEEKVLLEWAEKTSKKYVSKELSAEIRSRAEPFIKWLREAEEEDSDSEESDDDLPNLGALTFGKVVHAELLDFKYN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 5 Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).confidentP59325
Eukaryotic translation initiation factor 5 Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).confidentQ9VXK6
Eukaryotic translation initiation factor 5 Catalyzes the hydrolysis of GTP bound to the 40S ribosomal initiation complex (40S.mRNA.Met-tRNA[F].eIF-2.GTP) with the subsequent joining of a 60S ribosomal subunit resulting in the release of eIF-2 and the guanine nucleotide. The subsequent joining of a 60S ribosomal subunit results in the formation of a functional 80S initiation complex (80S.mRNA.Met-tRNA[F]).confidentQ07205

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2IU1, chain A
Confidence level:very confident
Coverage over the Query: 2-108
View the alignment between query and template
View the model in PyMOL