Diaphorina citri psyllid: psy15551


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640
MKAEIQDLKEKLDTMKIKYREKTRDLDEMKIQLDQSAEFKAKIMESQAASSLFRYREKTRDLDEMKIQLDQSAEFKAKIMESQAGLKRELEKLKQEKQEAVEAKEDTADLVETLEMMTLDKEMAEERAETLQVELDLAKEKIEELTLDIELMKADIEKSCDGAGDGTEVSHYQIKQLEQQNMRLRETLVRLRDLSAHEIFNNNKFDSRLRDLSAHEIFNNNKFDSRLRDLSAHEIFNNNKFDSRLYDLSAHEIFNNKNKFDSRLRDLSAHEIFNNKNKFDSRLRDLSAHEIFNNNKFDSRLRDLSAHEIFNNKNKFDSRLRDLSAHEKHEMSKLQKDIEEKKQENAELIKSQEKLKQRVTELEADCADLHEQVDAALGAEEMVQQLSVQKLELEDLVSKQAEEIVDLEALQVVSDQLQEDAKEIEIELKEEVEMARSATREVIREKEAALESLADRELTIVKFRELVIREKEAALESLADRELTIVKFRELNSLDEKVSTENIEKCVTYFNTFYPVLFPDTKFSHVGHLLMDYVKILSTASDCLQTDSKIIQALIQETMMPCECYSLFLHSYGNEIGREGSTENIEKCVTYFNTFYPVLFPGHPSFSSCGSLLMDYVKILSTACDCLQTDSKIIQALIQR
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHc
*KAEIQDLK***************************************************************************************************************************VELDLAKEKIEELTLDIELMKADIEKSC*********SHYQIKQLEQQNMRLRETLVRLRDLSAHEIFNNNKFDSRLRDLSAHEIFNNNKFDSRLRDLSAHEIFNNNKFDSRLYDLSAHEIFNNKNKFDSRLRDLSAHEIFNNKNKF***LRDLSAHEIFNNN*F********************************************************************CADLH*QVDAALGA**MVQQLSVQKLELEDLVSKQAEEIVDLEALQVV************************************LESLADRELTIVKFRELVIREKEAALESLADRELTIVKFRELNSLDEKVSTENIEKCVTYFNTFYPVLFPDTKFSHVGHLLMDYVKILSTASDCLQTDSKIIQALIQETMMPCECYSLFLHSYGNEIGREGSTENIEKCVTYFNTFYPVLFPGHPSFSSCGSLLMDYVKILSTACDCLQTDSKIIQALIQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKAExxxxxxxxxxxxxxxxxxxxxxxxxxxxLDQSAEFKAKIMESQAASSLFRYREKTRDLDEMKIQLDQSAEFxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxIEKSCDGAGDGTEVSHYQxxxxxxxxxxxxxxxxxxxxxSAHEIFNNNKFDSRLRDLSAHEIFNNNKFDSRLRDLSAHEIFNNNKFDSRLYDLSAHEIFNNKNKFDSRLRDLSAHEIFNNKNKFDSRLRDLSAHEIFNNNKFDSRLRDLSAHEIFNNKNKFDSRLRDLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVDAALGAEEMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVIREKEAALESLADRELTIVKFRELVIREKEAALESLADRELTIVKFRELNSLDEKVSTENIEKCVTYFNTFYPVLFPDTKFSHVGHLLMDYVKILSTASDCLQTDSKIIQALIQETMMPCECYSLFLHSYGNEIGREGSTENIEKCVTYFNTFYPVLFPGHPSFSSCGSLLMDYVKILSTACDCLQTDSKIIQALIQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 124-138
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 346-408
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 378-451
View the alignment between query and template
View the model in PyMOL
Template: 3NA7, chain A
Confidence level:probable
Coverage over the Query: 345-457
View the alignment between query and template
View the model in PyMOL
Template: 3MQ7, chain A
Confidence level:probable
Coverage over the Query: 86-158
View the alignment between query and template
View the model in PyMOL
Template: 3KTA, chain B
Confidence level:probable
Coverage over the Query: 583-629
View the alignment between query and template
View the model in PyMOL
Template: 3GHG, chain A
Confidence level:probable
Coverage over the Query: 118-184
View the alignment between query and template
View the model in PyMOL
Template: 1Y1U, chain A
Confidence level:probable
Coverage over the Query: 16-275
View the alignment between query and template
View the model in PyMOL
Template: 1G8X, chain A
Confidence level:probable
Coverage over the Query: 1-158
View the alignment between query and template
View the model in PyMOL