Diaphorina citri psyllid: psy15554

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------34
VVNFLNDLYTLFDRIIKGYDVYKVETIGDAYMVILAVTSVFFICVSVVSFALKTHPDMRVPTIRNSSFFISLDNSTAWVLHKEKTDPHAAFFYVELACNAWFTFELLVRAVVSPNIFQFIRSPVNVIDIIATLSFYTDILLQDKVQQSDILEFFSIIRILRLFKLTRHSPGLKILIHTFKASAKELTLLVFFLVLGIVVFASLVYYAERLQVSPNIFQFIRSPVNVIDIIATLSFYTDILLQDKVQQSDILEFFSIIRILRLFKLTRHSPGLKILIHTFKASAKELTLLVFFLVLGIVVFASLVYYAERLQTLDRLYEYSKLEIAIDYTSLKISSFLDV
cccccHHcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccCCccccccccccccccccccccHHEEHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHHHHHHHccccccccEEEEHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEccEEEEEEEcccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccccccccccccEEEEEEEEccccc
**NFLNDLYTLFDRIIKGYDVYKVETIGDAYMVILAVTSVFFICVSVVSFALKTHPDMRVPTIRNSSFFISLDNSTAWVLHKEKTDPHAAFFYVELACNAWFTFELLVRAVVSPNIFQFIRSPVNVIDIIATLSFYTDILLQDKVQQSDILEFFSIIRILRLFKLTRHSPGLKILIHTFKASAKELTLLVFFLVLGIVVFASLVYYAERLQVSPNIFQFIRSPVNVIDIIATLSFYTDILLQDKVQQSDILEFFSIIRILRLFKLTRHSPGLKILIHTFKASAKELTLLVFFLVLGIVVFASLVYYAERLQTLDRLYEYSKLEIAIDYTSLKISSFLDV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VVNFLNDLYTLFDRIIKGYDVYKVETIGDAYMVILAVTSVFFICVSVVSFALKTHPDMRVPTIRNSSFFISLDNSTAWVLHKEKTDPHAAFFYVELACNAWFTFELLVRAVVSPNIFQFIRSPVNVIDIIATLSFYTDILLQDKVQQSDILEFFSIIRILRLFKLTRHSPGLKILIHTFKASAKELTLLVFFLVLGIVVFASLVYYAERLQVSPNIFQFIRSPVNVIDIIATLSFYTDILLQDKVQQSDILEFFSIIRILRLFKLTRHSPGLKILIHTFKASAKELTLLVFFLVLGIVVFASLVYYAERLQTLDRLYEYSKLEIAIDYTSLKISSFLDV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0033267 [CC]axon partprobableGO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2R9R, chain B
Confidence level:very confident
Coverage over the Query: 15-281
View the alignment between query and template
View the model in PyMOL
Template: 2R9R, chain B
Confidence level:very confident
Coverage over the Query: 191-336
View the alignment between query and template
View the model in PyMOL