Diaphorina citri psyllid: psy15570


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MEMDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEVPR
ccccccccccccccccccEEEEEccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHccccccccc
*****G**QHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPI**VP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEVPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Phosphoribosyl pyrophosphate synthase-associated protein 1 Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.confidentQ08DW2
Phosphoribosyl pyrophosphate synthase-associated protein 1 Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.confidentQ14558
Phosphoribosyl pyrophosphate synthase-associated protein 1 Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.confidentQ9D0M1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0033673 [BP]negative regulation of kinase activityprobableGO:0042325, GO:0051348, GO:0019220, GO:0019222, GO:0050790, GO:0031323, GO:0051338, GO:0050789, GO:0051174, GO:0065007, GO:0043549, GO:0044092, GO:0008150, GO:0065009, GO:0050794, GO:0043086
GO:0005488 [MF]bindingprobableGO:0003674
GO:0030234 [MF]enzyme regulator activityprobableGO:0003674
GO:0006139 [BP]nucleobase-containing compound metabolic processprobableGO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0002189 [CC]ribose phosphate diphosphokinase complexprobableGO:0043234, GO:0005575, GO:0032991

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JI4, chain A
Confidence level:very confident
Coverage over the Query: 41-82
View the alignment between query and template
View the model in PyMOL