Psyllid ID: psy15570

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MEMDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEVPR
ccccccccccccccccccEEEEEccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHccccccccc
cccccccccccccccccEEEEEEccccEEEEEEccHccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHccccccccc
memdvgvpqhpakekppisvvgdvggrVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHgllssdapllieespidevpr
memdvgvpqhpakekppisvvgDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHgllssdapllieespidevpr
MEMDVGVPQHPAKEKPPISVVGDVGGRVAImvddmvddvHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEVPR
******************SVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLL***********
*****G**QHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPI**VP*
*************EKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEVPR
****VGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPI*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEMDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEVPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query84 2.2.26 [Sep-21-2011]
Q9D0M1356 Phosphoribosyl pyrophosph yes N/A 0.904 0.213 0.776 4e-23
Q63468356 Phosphoribosyl pyrophosph yes N/A 0.904 0.213 0.776 7e-23
Q14558356 Phosphoribosyl pyrophosph yes N/A 0.904 0.213 0.75 4e-22
Q08DW2356 Phosphoribosyl pyrophosph yes N/A 0.904 0.213 0.75 4e-22
A2VDS0369 Phosphoribosyl pyrophosph no N/A 0.904 0.205 0.776 2e-21
Q5ZL26369 Phosphoribosyl pyrophosph no N/A 0.904 0.205 0.763 7e-21
Q28DH0358 Phosphoribosyl pyrophosph yes N/A 0.940 0.220 0.678 7e-21
O08618369 Phosphoribosyl pyrophosph no N/A 0.904 0.205 0.763 8e-21
Q5RBA8369 Phosphoribosyl pyrophosph no N/A 0.904 0.205 0.763 8e-21
Q8R574369 Phosphoribosyl pyrophosph no N/A 0.904 0.205 0.763 8e-21
>sp|Q9D0M1|KPRA_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Mus musculus GN=Prpsap1 PE=1 SV=1 Back     alignment and function desciption
 Score =  106 bits (265), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 59/76 (77%), Positives = 71/76 (93%)

Query: 7   VPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLL 66
           +P   AKEKPPI+VVGDVGGR+AI+VDD++DDV SFVAAAE+LK+RGAYKIYV+ATHG+L
Sbjct: 230 LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGIL 289

Query: 67  SSDAPLLIEESPIDEV 82
           S++AP LIEESPIDEV
Sbjct: 290 SAEAPRLIEESPIDEV 305
Seems to play a negative regulatory role in 5-phosphoribose 1-diphosphate synthesis.
Mus musculus (taxid: 10090)
>sp|Q63468|KPRA_RAT Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Rattus norvegicus GN=Prpsap1 PE=1 SV=1 Back     alignment and function description
>sp|Q14558|KPRA_HUMAN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens GN=PRPSAP1 PE=1 SV=2 Back     alignment and function description
>sp|Q08DW2|KPRA_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Bos taurus GN=PRPSAP1 PE=2 SV=1 Back     alignment and function description
>sp|A2VDS0|KPRB_BOVIN Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Bos taurus GN=PRPSAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZL26|KPRB_CHICK Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus GN=PRPSAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q28DH0|KPRB_XENTR Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Xenopus tropicalis GN=prpsap2 PE=2 SV=1 Back     alignment and function description
>sp|O08618|KPRB_RAT Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus GN=Prpsap2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RBA8|KPRB_PONAB Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii GN=PRPSAP2 PE=2 SV=1 Back     alignment and function description
>sp|Q8R574|KPRB_MOUSE Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus GN=Prpsap2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
239790761 356 ACYPI001614 [Acyrthosiphon pisum] 0.976 0.230 0.890 2e-34
328710612 356 PREDICTED: phosphoribosyl pyrophosphate 0.976 0.230 0.890 2e-34
332026884 356 Phosphoribosyl pyrophosphate synthetase- 0.976 0.230 0.890 3e-34
66561731 354 PREDICTED: phosphoribosyl pyrophosphate 0.976 0.231 0.878 4e-34
350423269 354 PREDICTED: phosphoribosyl pyrophosphate 0.976 0.231 0.878 5e-34
307182198 356 Phosphoribosyl pyrophosphate synthetase- 0.976 0.230 0.878 1e-33
340727191 354 PREDICTED: phosphoribosyl pyrophosphate 0.976 0.231 0.865 1e-33
307199437 311 Phosphoribosyl pyrophosphate synthetase- 0.976 0.263 0.865 5e-33
357625877 355 ribose-phosphate pyrophosphokinase 1,2 [ 0.976 0.230 0.853 1e-32
383858036 354 PREDICTED: phosphoribosyl pyrophosphate 0.976 0.231 0.853 3e-32
>gi|239790761|dbj|BAH71921.1| ACYPI001614 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 73/82 (89%), Positives = 78/82 (95%)

Query: 1   MEMDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVL 60
           M++ VGVPQHPAKEKPPI+VVGDVGGR+AIMVDDMVDDV SFVAAAEVLK+RGAYKIYVL
Sbjct: 224 MDVGVGVPQHPAKEKPPINVVGDVGGRIAIMVDDMVDDVASFVAAAEVLKERGAYKIYVL 283

Query: 61  ATHGLLSSDAPLLIEESPIDEV 82
           ATHGLLSSDAP LIE SPIDEV
Sbjct: 284 ATHGLLSSDAPRLIESSPIDEV 305

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328710612|ref|XP_003244313.1| PREDICTED: phosphoribosyl pyrophosphate synthase-associated protein 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|332026884|gb|EGI66985.1| Phosphoribosyl pyrophosphate synthetase-associated protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|66561731|ref|XP_624652.1| PREDICTED: phosphoribosyl pyrophosphate synthase-associated protein 2-like [Apis mellifera] gi|380027878|ref|XP_003697642.1| PREDICTED: phosphoribosyl pyrophosphate synthase-associated protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|350423269|ref|XP_003493426.1| PREDICTED: phosphoribosyl pyrophosphate synthase-associated protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307182198|gb|EFN69532.1| Phosphoribosyl pyrophosphate synthetase-associated protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340727191|ref|XP_003401932.1| PREDICTED: phosphoribosyl pyrophosphate synthase-associated protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307199437|gb|EFN80050.1| Phosphoribosyl pyrophosphate synthetase-associated protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|357625877|gb|EHJ76166.1| ribose-phosphate pyrophosphokinase 1,2 [Danaus plexippus] Back     alignment and taxonomy information
>gi|383858036|ref|XP_003704509.1| PREDICTED: phosphoribosyl pyrophosphate synthase-associated protein 2-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query84
MGI|MGI:1915013356 Prpsap1 "phosphoribosyl pyroph 0.904 0.213 0.697 6.1e-23
RGD|620206356 Prpsap1 "phosphoribosyl pyroph 0.904 0.213 0.697 1.3e-22
UNIPROTKB|G3V7B5385 Prpsap1 "Phosphoribosyl pyroph 0.904 0.197 0.697 1.3e-22
UNIPROTKB|E1BYN9383 PRPSAP1 "Uncharacterized prote 0.904 0.198 0.697 2.6e-22
UNIPROTKB|A2VDS0369 PRPSAP2 "Phosphoribosyl pyroph 0.904 0.205 0.697 3.4e-22
UNIPROTKB|J9NVA0385 PRPSAP1 "Uncharacterized prote 0.904 0.197 0.684 4.6e-22
UNIPROTKB|F1RWP0385 PRPSAP1 "Uncharacterized prote 0.904 0.197 0.684 4.6e-22
UNIPROTKB|B4DP31282 PRPSAP1 "cDNA FLJ57408, highly 0.904 0.269 0.671 5.5e-22
UNIPROTKB|Q14558356 PRPSAP1 "Phosphoribosyl pyroph 0.904 0.213 0.671 5.5e-22
ZFIN|ZDB-GENE-040704-40353 zgc:91845 "zgc:91845" [Danio r 0.904 0.215 0.671 7e-22
MGI|MGI:1915013 Prpsap1 "phosphoribosyl pyrophosphate synthetase-associated protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 265 (98.3 bits), Expect = 6.1e-23, P = 6.1e-23
 Identities = 53/76 (69%), Positives = 62/76 (81%)

Query:     7 VPQHPAKEKPPISVVGDVGGRVAIXXXXXXXXXHSFVAAAEVLKDRGAYKIYVLATHGLL 66
             +P   AKEKPPI+VVGDVGGR+AI          SFVAAAE+LK+RGAYKIYV+ATHG+L
Sbjct:   230 LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGIL 289

Query:    67 SSDAPLLIEESPIDEV 82
             S++AP LIEESPIDEV
Sbjct:   290 SAEAPRLIEESPIDEV 305
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0002189 "ribose phosphate diphosphokinase complex" evidence=ISO
GO:0004749 "ribose phosphate diphosphokinase activity" evidence=IEA
GO:0009165 "nucleotide biosynthetic process" evidence=IEA
GO:0019900 "kinase binding" evidence=ISO
GO:0030234 "enzyme regulator activity" evidence=ISO
GO:0033673 "negative regulation of kinase activity" evidence=ISO
GO:0043234 "protein complex" evidence=ISO
RGD|620206 Prpsap1 "phosphoribosyl pyrophosphate synthetase-associated protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V7B5 Prpsap1 "Phosphoribosyl pyrophosphate synthetase-associated protein 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYN9 PRPSAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A2VDS0 PRPSAP2 "Phosphoribosyl pyrophosphate synthase-associated protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NVA0 PRPSAP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWP0 PRPSAP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B4DP31 PRPSAP1 "cDNA FLJ57408, highly similar to Phosphoribosyl pyrophosphatesynthetase-associated protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q14558 PRPSAP1 "Phosphoribosyl pyrophosphate synthase-associated protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-40 zgc:91845 "zgc:91845" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q08DW2KPRA_BOVINNo assigned EC number0.750.90470.2134yesN/A
Q8R753KPRS_THETN2, ., 7, ., 6, ., 10.50760.77380.2056yesN/A
Q9D0M1KPRA_MOUSENo assigned EC number0.77630.90470.2134yesN/A
Q63468KPRA_RATNo assigned EC number0.77630.90470.2134yesN/A
Q28DH0KPRB_XENTRNo assigned EC number0.67810.94040.2206yesN/A
Q14558KPRA_HUMANNo assigned EC number0.750.90470.2134yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
PRK01259309 PRK01259, PRK01259, ribose-phosphate pyrophosphoki 1e-18
COG0462314 COG0462, PrsA, Phosphoribosylpyrophosphate synthet 1e-18
TIGR01251308 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosph 2e-17
PRK03092304 PRK03092, PRK03092, ribose-phosphate pyrophosphoki 1e-14
PLN02369302 PLN02369, PLN02369, ribose-phosphate pyrophosphoki 1e-13
PTZ00145439 PTZ00145, PTZ00145, phosphoribosylpyrophosphate sy 2e-12
PRK02458323 PRK02458, PRK02458, ribose-phosphate pyrophosphoki 4e-12
PRK00553332 PRK00553, PRK00553, ribose-phosphate pyrophosphoki 3e-11
PRK02269320 PRK02269, PRK02269, ribose-phosphate pyrophosphoki 4e-11
PRK04923319 PRK04923, PRK04923, ribose-phosphate pyrophosphoki 1e-10
PRK02812330 PRK02812, PRK02812, ribose-phosphate pyrophosphoki 6e-10
PRK00934285 PRK00934, PRK00934, ribose-phosphate pyrophosphoki 9e-09
cd06223130 cd06223, PRTases_typeI, Phosphoribosyl transferase 3e-08
PRK06827382 PRK06827, PRK06827, phosphoribosylpyrophosphate sy 2e-07
PRK07199301 PRK07199, PRK07199, phosphoribosylpyrophosphate sy 0.001
>gnl|CDD|234929 PRK01259, PRK01259, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information 
 Score = 77.1 bits (191), Expect = 1e-18
 Identities = 32/63 (50%), Positives = 41/63 (65%)

Query: 20  VVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPI 79
           ++GDV GR  I+VDDM+D   +   AAE LK+RGA  +Y  ATH +LS  A   IE S I
Sbjct: 202 IIGDVEGRDCILVDDMIDTAGTLCKAAEALKERGAKSVYAYATHPVLSGGAIERIENSVI 261

Query: 80  DEV 82
           DE+
Sbjct: 262 DEL 264

Length = 309
>gnl|CDD|223538 COG0462, PrsA, Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130318 TIGR01251, ribP_PPkin, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|179535 PRK03092, PRK03092, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|215209 PLN02369, PLN02369, ribose-phosphate pyrophosphokinase Back     alignment and domain information
>gnl|CDD|240290 PTZ00145, PTZ00145, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235039 PRK02458, PRK02458, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|179062 PRK00553, PRK00553, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|167353 PRK02269, PRK02269, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|179893 PRK04923, PRK04923, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|235072 PRK02812, PRK02812, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|234868 PRK00934, PRK00934, ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>gnl|CDD|206754 cd06223, PRTases_typeI, Phosphoribosyl transferase (PRT)-type I domain Back     alignment and domain information
>gnl|CDD|180714 PRK06827, PRK06827, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235960 PRK07199, PRK07199, phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 84
PF14572184 Pribosyl_synth: Phosphoribosyl synthetase-associat 99.89
COG0462314 PrsA Phosphoribosylpyrophosphate synthetase [Nucle 99.81
PRK04923319 ribose-phosphate pyrophosphokinase; Provisional 99.78
PRK02269320 ribose-phosphate pyrophosphokinase; Provisional 99.78
PRK02458323 ribose-phosphate pyrophosphokinase; Provisional 99.78
PTZ00145439 phosphoribosylpyrophosphate synthetase; Provisiona 99.76
PRK07199301 phosphoribosylpyrophosphate synthetase; Provisiona 99.74
PRK00553332 ribose-phosphate pyrophosphokinase; Provisional 99.73
PRK03092304 ribose-phosphate pyrophosphokinase; Provisional 99.72
PLN02297326 ribose-phosphate pyrophosphokinase 99.69
PRK02812330 ribose-phosphate pyrophosphokinase; Provisional 99.69
KOG1448|consensus316 99.68
PLN02369302 ribose-phosphate pyrophosphokinase 99.68
PRK00934285 ribose-phosphate pyrophosphokinase; Provisional 99.66
PRK01259309 ribose-phosphate pyrophosphokinase; Provisional 99.66
PRK06827382 phosphoribosylpyrophosphate synthetase; Provisiona 99.65
KOG1503|consensus354 99.65
TIGR01251308 ribP_PPkin ribose-phosphate pyrophosphokinase. In 99.57
PRK08525445 amidophosphoribosyltransferase; Provisional 99.51
PRK05793469 amidophosphoribosyltransferase; Provisional 99.38
PLN02293187 adenine phosphoribosyltransferase 99.33
PRK13811170 orotate phosphoribosyltransferase; Provisional 99.27
TIGR00201190 comF comF family protein. This protein is found in 99.27
PRK13812176 orotate phosphoribosyltransferase; Provisional 99.26
PRK13809206 orotate phosphoribosyltransferase; Provisional 99.24
PRK00129209 upp uracil phosphoribosyltransferase; Reviewed 99.24
PF00156125 Pribosyltran: Phosphoribosyl transferase domain; I 99.23
PRK02304175 adenine phosphoribosyltransferase; Provisional 99.23
PRK11595227 DNA utilization protein GntX; Provisional 99.22
TIGR01091207 upp uracil phosphoribosyltransferase. that include 99.19
PRK09162181 hypoxanthine-guanine phosphoribosyltransferase; Pr 99.17
TIGR01090169 apt adenine phosphoribosyltransferase. A phylogene 99.16
COG1040225 ComFC Predicted amidophosphoribosyltransferases [G 99.16
PRK13810187 orotate phosphoribosyltransferase; Provisional 99.15
PRK02277200 orotate phosphoribosyltransferase-like protein; Pr 99.11
TIGR01203166 HGPRTase hypoxanthine phosphoribosyltransferase. S 99.1
PRK05205176 bifunctional pyrimidine regulatory protein PyrR ur 99.1
PRK12560187 adenine phosphoribosyltransferase; Provisional 99.08
PRK07272484 amidophosphoribosyltransferase; Provisional 99.08
TIGR00336173 pyrE orotate phosphoribosyltransferase. The conser 99.07
PRK00455202 pyrE orotate phosphoribosyltransferase; Validated 99.03
PLN02238189 hypoxanthine phosphoribosyltransferase 99.02
PRK09123479 amidophosphoribosyltransferase; Provisional 99.02
PRK07322178 adenine phosphoribosyltransferase; Provisional 99.0
PRK15423178 hypoxanthine phosphoribosyltransferase; Provisiona 98.96
TIGR01367187 pyrE_Therm orotate phosphoribosyltransferase, Ther 98.95
TIGR01744191 XPRTase xanthine phosphoribosyltransferase. This m 98.93
PTZ00271211 hypoxanthine-guanine phosphoribosyltransferase; Pr 98.93
PRK09246501 amidophosphoribosyltransferase; Provisional 98.92
PTZ00149241 hypoxanthine phosphoribosyltransferase; Provisiona 98.9
PRK09219189 xanthine phosphoribosyltransferase; Validated 98.89
COG0856203 Orotate phosphoribosyltransferase homologs [Nucleo 98.89
COG0634178 Hpt Hypoxanthine-guanine phosphoribosyltransferase 98.89
PRK06031233 phosphoribosyltransferase; Provisional 98.87
PRK08341442 amidophosphoribosyltransferase; Provisional 98.86
PRK05500477 bifunctional orotidine 5'-phosphate decarboxylase/ 98.86
PRK06781471 amidophosphoribosyltransferase; Provisional 98.85
PLN02440479 amidophosphoribosyltransferase 98.83
KOG3367|consensus216 98.81
PRK07631475 amidophosphoribosyltransferase; Provisional 98.81
COG0461201 PyrE Orotate phosphoribosyltransferase [Nucleotide 98.78
TIGR01134442 purF amidophosphoribosyltransferase. Alternate nam 98.77
KOG1712|consensus183 98.75
PRK06388474 amidophosphoribosyltransferase; Provisional 98.75
PRK07349500 amidophosphoribosyltransferase; Provisional 98.74
COG0503179 Apt Adenine/guanine phosphoribosyltransferases and 98.71
COG0035210 Upp Uracil phosphoribosyltransferase [Nucleotide t 98.7
COG1926220 Predicted phosphoribosyltransferases [General func 98.66
PLN02541244 uracil phosphoribosyltransferase 98.66
PRK07847510 amidophosphoribosyltransferase; Provisional 98.61
PRK08558238 adenine phosphoribosyltransferase; Provisional 98.61
PF14681207 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V 98.56
TIGR01743268 purR_Bsub pur operon repressor, Bacillus subtilis 98.35
PRK09177156 xanthine-guanine phosphoribosyltransferase; Valida 98.3
COG2236192 Predicted phosphoribosyltransferases [General func 98.29
PRK09213271 pur operon repressor; Provisional 98.28
COG2065179 PyrR Pyrimidine operon attenuation protein/uracil 98.25
COG0034470 PurF Glutamine phosphoribosylpyrophosphate amidotr 98.01
KOG0572|consensus474 97.76
PF15609191 PRTase_2: Phosphoribosyl transferase 97.41
KOG1017|consensus267 96.3
PF15610274 PRTase_3: PRTase ComF-like 93.41
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 86.59
KOG0814|consensus 237 84.73
PF13793116 Pribosyltran_N: N-terminal domain of ribose phosph 82.4
smart00450100 RHOD Rhodanese Homology Domain. An alpha beta fold 81.71
PF10662143 PduV-EutP: Ethanolamine utilisation - propanediol 81.41
>PF14572 Pribosyl_synth: Phosphoribosyl synthetase-associated domain; PDB: 2H07_B 2H06_B 3S5J_B 2HCR_A 3EFH_A 2H08_A 1DKR_B 1DKU_B 1IBS_B 2JI4_A Back     alignment and domain information 
Probab=99.89  E-value=1.6e-23  Score=144.60  Aligned_cols=80  Identities=54%  Similarity=0.893  Sum_probs=58.8

Q ss_pred             CCCCCCcccCCCCCCeeeeccCCCCEEEEEeccccchHHHHHHHHHHHHcCCCeEEEEEEeccCCCCHHHHhhcCCCCcC
Q psy15570          3 MDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEV   82 (84)
Q Consensus         3 ~~~~~~~~~~~~~~~~~i~g~v~gk~vlivDDii~TG~Tl~~~~~~L~~~ga~~v~~~~~h~~~s~~a~~~l~~~~i~~i   82 (84)
                      ....+|...+++...+.++||++||.|+|+|||++||+|+..+++.|+++||++|++++|||+|+++|.++|++++++++
T Consensus        60 ~~~~~~~~~~~e~~~~~vVGDV~gk~~IIvDDiIdtg~Tl~~aA~~Lk~~GA~~V~~~aTHgvfs~~A~~~l~~s~Id~v  139 (184)
T PF14572_consen   60 SSEEIPEMTPKEKPPMNVVGDVKGKICIIVDDIIDTGGTLIKAAELLKERGAKKVYACATHGVFSGDAPERLEESPIDEV  139 (184)
T ss_dssp             ---------------EEEES--TTSEEEEEEEEESSTHHHHHHHHHHHHTTESEEEEEEEEE---TTHHHHHHHSSESEE
T ss_pred             ccchhhhcccCcccceEEEEEccCCeEeeecccccchHHHHHHHHHHHHcCCCEEEEEEeCcccCchHHHHHhhcCCeEE
Confidence            45567877888999999999999999999999999999999999999999999999999999999999999999999875

...
>COG0462 PrsA Phosphoribosylpyrophosphate synthetase [Nucleotide transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK04923 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02269 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK02458 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PTZ00145 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK07199 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>PRK00553 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK03092 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PLN02297 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK02812 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>KOG1448|consensus Back     alignment and domain information
>PLN02369 ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK00934 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK01259 ribose-phosphate pyrophosphokinase; Provisional Back     alignment and domain information
>PRK06827 phosphoribosylpyrophosphate synthetase; Provisional Back     alignment and domain information
>KOG1503|consensus Back     alignment and domain information
>TIGR01251 ribP_PPkin ribose-phosphate pyrophosphokinase Back     alignment and domain information
>PRK08525 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05793 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02293 adenine phosphoribosyltransferase Back     alignment and domain information
>PRK13811 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00201 comF comF family protein Back     alignment and domain information
>PRK13812 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK13809 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK00129 upp uracil phosphoribosyltransferase; Reviewed Back     alignment and domain information
>PF00156 Pribosyltran: Phosphoribosyl transferase domain; InterPro: IPR000836 The name PRT comes from phosphoribosyltransferase (PRTase) enzymes, which carry out phosphoryl transfer reactions on 5-phosphoribosyl-alpha1-pyrophosphate PRPP, an activated form of ribose-5-phosphate Back     alignment and domain information
>PRK02304 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK11595 DNA utilization protein GntX; Provisional Back     alignment and domain information
>TIGR01091 upp uracil phosphoribosyltransferase Back     alignment and domain information
>PRK09162 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01090 apt adenine phosphoribosyltransferase Back     alignment and domain information
>COG1040 ComFC Predicted amidophosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK13810 orotate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK02277 orotate phosphoribosyltransferase-like protein; Provisional Back     alignment and domain information
>TIGR01203 HGPRTase hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK05205 bifunctional pyrimidine regulatory protein PyrR uracil phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK12560 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07272 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR00336 pyrE orotate phosphoribosyltransferase Back     alignment and domain information
>PRK00455 pyrE orotate phosphoribosyltransferase; Validated Back     alignment and domain information
>PLN02238 hypoxanthine phosphoribosyltransferase Back     alignment and domain information
>PRK09123 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07322 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK15423 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>TIGR01367 pyrE_Therm orotate phosphoribosyltransferase, Thermus family Back     alignment and domain information
>TIGR01744 XPRTase xanthine phosphoribosyltransferase Back     alignment and domain information
>PTZ00271 hypoxanthine-guanine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09246 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PTZ00149 hypoxanthine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK09219 xanthine phosphoribosyltransferase; Validated Back     alignment and domain information
>COG0856 Orotate phosphoribosyltransferase homologs [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0634 Hpt Hypoxanthine-guanine phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK06031 phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08341 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05500 bifunctional orotidine 5'-phosphate decarboxylase/orotate phosphoribosyltransferase protein; Validated Back     alignment and domain information
>PRK06781 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PLN02440 amidophosphoribosyltransferase Back     alignment and domain information
>KOG3367|consensus Back     alignment and domain information
>PRK07631 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0461 PyrE Orotate phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>TIGR01134 purF amidophosphoribosyltransferase Back     alignment and domain information
>KOG1712|consensus Back     alignment and domain information
>PRK06388 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK07349 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>COG0503 Apt Adenine/guanine phosphoribosyltransferases and related PRPP-binding proteins [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0035 Upp Uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG1926 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PLN02541 uracil phosphoribosyltransferase Back     alignment and domain information
>PRK07847 amidophosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK08558 adenine phosphoribosyltransferase; Provisional Back     alignment and domain information
>PF14681 UPRTase: Uracil phosphoribosyltransferase; PDB: 1V9S_B 1UPF_A 1UPU_D 1JLR_B 1BD4_A 1BD3_C 1JLS_D 1XTV_C 1XTU_H 3G6W_C Back     alignment and domain information
>TIGR01743 purR_Bsub pur operon repressor, Bacillus subtilis type Back     alignment and domain information
>PRK09177 xanthine-guanine phosphoribosyltransferase; Validated Back     alignment and domain information
>COG2236 Predicted phosphoribosyltransferases [General function prediction only] Back     alignment and domain information
>PRK09213 pur operon repressor; Provisional Back     alignment and domain information
>COG2065 PyrR Pyrimidine operon attenuation protein/uracil phosphoribosyltransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG0034 PurF Glutamine phosphoribosylpyrophosphate amidotransferase [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG0572|consensus Back     alignment and domain information
>PF15609 PRTase_2: Phosphoribosyl transferase Back     alignment and domain information
>KOG1017|consensus Back     alignment and domain information
>PF15610 PRTase_3: PRTase ComF-like Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>KOG0814|consensus Back     alignment and domain information
>PF13793 Pribosyltran_N: N-terminal domain of ribose phosphate pyrophosphokinase; PDB: 2JI4_A 1DKU_B 1IBS_B 1DKR_B 3MBI_C 3LRT_B 3LPN_B 3NAG_B 2H07_B 2H06_B Back     alignment and domain information
>smart00450 RHOD Rhodanese Homology Domain Back     alignment and domain information
>PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
2c4k_A370 Crystal Structure Of Human Phosphoribosylpyrophosph 5e-23
2ji4_A379 Human Phosphoribosylpyrophosphate Synthetase - Asso 5e-21
3dah_A319 2.3 A Crystal Structure Of Ribose-Phosphate Pyropho 2e-05
>pdb|2C4K|A Chain A, Crystal Structure Of Human Phosphoribosylpyrophosphate Synthetase-Associated Protein 39 (Pap39) Length = 370 Back     alignment and structure 
Iteration: 1

 Score =  102 bits (254), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%)
Query: 7   VPQHPAKEKPPISVVGDVGGRVAIXXXXXXXXXHSFVAAAEVLKDRGAYKIYVLATHGLL 66
           +P   AKEKPPI+VVGDVGGR+AI          SFVAAAE+LK+RGAYKIYV+ATHG+L
Sbjct: 249 LPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVMATHGIL 308
Query: 67  SSDAPLLIEESPIDEV 82
           S++AP LIEES +DEV
Sbjct: 309 SAEAPRLIEESSVDEV 324
>pdb|2JI4|A Chain A, Human Phosphoribosylpyrophosphate Synthetase - Associated Protein 41 (Pap41) Length = 379 Back     alignment and structure
>pdb|3DAH|A Chain A, 2.3 A Crystal Structure Of Ribose-Phosphate Pyrophosphokinase From Burkholderia Pseudomallei Length = 319 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query84
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 4e-32
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 3e-20
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 7e-20
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 2e-19
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 3e-19
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 3e-17
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Length = 379 Back     alignment and structure
 Score =  113 bits (284), Expect = 4e-32
 Identities = 57/82 (69%), Positives = 69/82 (84%)

Query: 1   MEMDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVL 60
           +   + +P    KEKPPI+VVGDVGGR+AI+VDD++DDV SF+AAAE LK+RGAYKI+V+
Sbjct: 247 IHPSLEIPMLIPKEKPPITVVGDVGGRIAIIVDDIIDDVDSFLAAAETLKERGAYKIFVM 306

Query: 61  ATHGLLSSDAPLLIEESPIDEV 82
           ATHGLLSSDAP  IEES IDEV
Sbjct: 307 ATHGLLSSDAPRRIEESAIDEV 328
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Length = 317 Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Length = 326 Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Length = 319 Back     alignment and structure
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Length = 284 Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Length = 286 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
1u9y_A284 RPPK;, ribose-phosphate pyrophosphokinase; PRPP sy 99.73
1dku_A317 Protein (phosphoribosyl pyrophosphate synthetase); 99.73
3s5j_B326 Ribose-phosphate pyrophosphokinase 1; nucleotide s 99.72
3dah_A319 Ribose-phosphate pyrophosphokinase; pyrophosphoki 99.72
2ji4_A379 Phosphoribosyl pyrophosphate synthetase-associated 99.7
3lrt_A286 Ribose-phosphate pyrophosphokinase; phosphoribosyl 99.67
3dez_A243 OPRT, oprtase, orotate phosphoribosyltransferase; 99.44
2aee_A211 OPRT, oprtase, orotate phosphoribosyltransferase; 99.42
3m3h_A234 OPRT, oprtase, orotate phosphoribosyltransferase; 99.41
1zn8_A180 APRT, adenine phosphoribosyltransferase; glycosylt 99.4
2yzk_A178 OPRT, oprtase, orotate phosphoribosyltransferase; 99.39
1y0b_A197 Xanthine phosphoribosyltransferase; purine metabol 99.37
2wns_A205 Orotate phosphoribosyltransferase; alternative spl 99.36
1wd5_A208 Hypothetical protein TT1426; structural genomics, 99.36
1i5e_A209 Uracil phosphoribosyltransferase; salvage pathway; 99.32
2dy0_A190 APRT, adenine phosphoribosyltransferase; structura 99.3
1vdm_A153 Purine phosphoribosyltransferase; structural genom 99.27
1o5o_A221 Uracil phosphoribosyltransferase; TM0721, structur 99.27
1qb7_A236 APRT, adenine phosphoribosyltransferase; dinucleot 99.26
2e55_A208 Uracil phosphoribosyltransferase; structural genom 99.25
1l1q_A186 Adenine phosphoribosyltransferase; aprtase, giardi 99.24
2p1z_A180 Phosphoribosyltransferase; STRU genomics, PSI-2, p 99.24
1v9s_A208 Uracil phosphoribosyltransferase; pyrimidine salva 99.23
1ecf_A504 Glutamine phosphoribosylpyrophosphate amidotransf; 99.22
2ehj_A208 Uracil phosphoribosyltransferase; structural genom 99.22
1vch_A175 Phosphoribosyltransferase-related protein; structu 99.21
1a3c_A181 PYRR, pyrimidine operon regulatory protein PYRR; t 99.2
2geb_A185 Hypoxanthine-guanine phosphoribosyltransferase; HG 99.19
1hgx_A183 HGXPRTASE, hypoxanthine-guanine-xanthine phosphori 99.18
1ao0_A459 Glutamine phosphoribosylpyrophosphate amidotransfe 99.18
1ufr_A181 TT1027, PYR mRNA-binding attenuation protein; pyri 99.18
1yfz_A205 Hypoxanthine-guanine phosphoribosyltransferase; pr 99.16
1g2q_A187 Adenine phosphoribosyltransferase 1; dimer, single 99.14
1tc1_A220 Protein (hypoxanthine phosphoribosyltransferase); 99.14
2ywu_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 99.14
1pzm_A211 HGPRT, hypoxanthine-guanine phosphoribosyltransfer 99.12
3mjd_A232 Orotate phosphoribosyltransferase; IDP02311, csgid 99.12
1bd3_D243 Uprtase, uracil phosphoribosyltransferase; glycosy 99.12
2jbh_A225 Phosphoribosyltransferase domain-containing prote; 99.09
3ohp_A177 Hypoxanthine phosphoribosyltransferase; structural 99.08
1fsg_A233 HGPRTASE, hypoxanthine-guanine phosphoribosyltrans 99.08
3o7m_A186 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.08
3hvu_A204 Hypoxanthine phosphoribosyltransferase; hypoxanthi 99.06
2ps1_A226 Orotate phosphoribosyltransferase 1; alpha beta, o 99.05
1w30_A201 PYRR bifunctional protein; transferase, glycosyltr 99.05
1z7g_A217 HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribos 99.03
3qw4_B453 UMP synthase; N-terminal orotidine monophosphate d 99.02
3dmp_A217 Uracil phosphoribosyltransferase; structural genom 98.98
1lh0_A213 OMP synthase; loop closure, monomer closure, orota 98.94
3ozf_A250 Hypoxanthine-guanine-xanthine phosphoribosyltrans; 98.93
3n2l_A238 OPRT, oprtase, orotate phosphoribosyltransferase; 98.93
3acd_A181 Hypoxanthine-guanine phosphoribosyltransferase; ro 98.9
2xbu_A221 Hypoxanthine-guanine phosphoribosyltransferase; gl 98.88
1xtt_A216 Probable uracil phosphoribosyltransferase; tetrame 98.82
1o57_A291 PUR operon repressor; purine operon repressor, hel 98.79
1dqn_A230 Guanine phosphoribosyltransferase; protein-inhibit 98.54
1nul_A152 XPRT, xanthine-guanine phosphoribosyltransferase; 98.52
>1u9y_A RPPK;, ribose-phosphate pyrophosphokinase; PRPP synthase, transferase; 2.65A {Methanocaldococcus jannaschii} SCOP: c.61.1.2 c.61.1.2 PDB: 1u9z_A* Back     alignment and structure
Probab=99.73  E-value=2.4e-18  Score=123.52  Aligned_cols=66  Identities=29%  Similarity=0.397  Sum_probs=61.7

Q ss_pred             Ceeeec-cCCCCEEEEEeccccchHHHHHHHHHHHHcCCCeEEEEEEeccCCCCHHHHhhcCCCCcC
Q psy15570         17 PISVVG-DVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEESPIDEV   82 (84)
Q Consensus        17 ~~~i~g-~v~gk~vlivDDii~TG~Tl~~~~~~L~~~ga~~v~~~~~h~~~s~~a~~~l~~~~i~~i   82 (84)
                      .+++.| +++||+|+||||++|||+|+..+++.|+++|+++++++++|++|++++.++|.+++++++
T Consensus       195 ~~~l~g~~v~Gk~VlIVDDii~TG~Tl~~aa~~Lk~~Ga~~V~~~~~h~v~s~~a~~~l~~~~i~~v  261 (284)
T 1u9y_A          195 QIAPKTLDAKDRDVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLIGDALNKLYSAGVEEV  261 (284)
T ss_dssp             -CCBSSCCCTTCCEEEEEEECSSSHHHHHHHHHHHHTTCCSEEEEEEECCCCTTHHHHHHHHTCSEE
T ss_pred             EEEecCccCCCCEEEEEecccCchHHHHHHHHHHHHCCCcEEEEEEEeEecCcHHHHHHHhCCCCEE
Confidence            566777 899999999999999999999999999999999999999999999999999999998875
>1dku_A Protein (phosphoribosyl pyrophosphate synthetase); open alpha-beta structure, domain duplication, phosphoribosyltransferase type I fold; HET: AP2 ABM; 2.20A {Bacillus subtilis} SCOP: c.61.1.2 c.61.1.2 PDB: 1dkr_A* 1ibs_A* Back     alignment and structure
>3s5j_B Ribose-phosphate pyrophosphokinase 1; nucleotide synthesis, transferase; 2.02A {Homo sapiens} PDB: 2hcr_A* 3efh_A 2h06_A 2h07_A 2h08_A Back     alignment and structure
>3dah_A Ribose-phosphate pyrophosphokinase; pyrophosphoki seattle structural genomics center for infectious disease, magnesium, metal binding; HET: AMP; 2.30A {Burkholderia pseudomallei} Back     alignment and structure
>2ji4_A Phosphoribosyl pyrophosphate synthetase-associated protein 2; phosphorylation, nucleotide biosynthesis, transferase; 2.55A {Homo sapiens} PDB: 2c4k_A* Back     alignment and structure
>3lrt_A Ribose-phosphate pyrophosphokinase; phosphoribosyl transferase, ATP analog binding, ATP-binding, metal-binding, nucleotide biosynthesis; HET: ADP; 1.53A {Thermoplasma volcanium} PDB: 3lpn_A* 3nag_A* 3mbi_A* Back     alignment and structure
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans} Back     alignment and structure
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1 Back     alignment and structure
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A* Back     alignment and structure
>1zn8_A APRT, adenine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: AMP; 1.76A {Homo sapiens} SCOP: c.61.1.1 PDB: 1ore_A* 1zn7_A* 1zn9_A* Back     alignment and structure
>2yzk_A OPRT, oprtase, orotate phosphoribosyltransferase; rossmann fold, glycosyltransferase, magnesium, pyrimidine biosynthesis, structural genomics; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, STRU genomics, PSI, protein structure initative, midwest center structural genomics; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A* Back     alignment and structure
>2wns_A Orotate phosphoribosyltransferase; alternative splicing, multifunctional enzyme, lyase, polymorphism, decarboxylase, phosphoprotein; HET: OMP; 1.90A {Homo sapiens} Back     alignment and structure
>1wd5_A Hypothetical protein TT1426; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; HET: MES; 2.00A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1i5e_A Uracil phosphoribosyltransferase; salvage pathway; HET: U5P; 3.00A {Bacillus caldolyticus} SCOP: c.61.1.1 Back     alignment and structure
>2dy0_A APRT, adenine phosphoribosyltransferase; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.25A {Escherichia coli K12} Back     alignment and structure
>1vdm_A Purine phosphoribosyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Pyrococcus horikoshii} SCOP: c.61.1.1 Back     alignment and structure
>1o5o_A Uracil phosphoribosyltransferase; TM0721, structural genomic PSI, protein structure initiative, joint center for structu genomics; HET: U5P; 2.30A {Thermotoga maritima} SCOP: c.61.1.1 Back     alignment and structure
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A* Back     alignment and structure
>2e55_A Uracil phosphoribosyltransferase; structural genomics; 2.15A {Aquifex aeolicus} Back     alignment and structure
>1l1q_A Adenine phosphoribosyltransferase; aprtase, giardia lamblia, purine metabolism, cataly transferase; HET: 9DA; 1.85A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1l1r_A* Back     alignment and structure
>2p1z_A Phosphoribosyltransferase; STRU genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.44A {Corynebacterium diphtheriae} Back     alignment and structure
>1v9s_A Uracil phosphoribosyltransferase; pyrimidine salvage, oligomerization, structural genomics, RI structural genomics/proteomics initiative; 2.10A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1ecf_A Glutamine phosphoribosylpyrophosphate amidotransf; purine biosynthesis, transferase, glycosyltransferase, gluta amidotransferase; HET: PIN; 2.00A {Escherichia coli} SCOP: c.61.1.1 d.153.1.1 PDB: 1ecb_A* 1ecc_A* 1ecg_A* 1ecj_A* Back     alignment and structure
>2ehj_A Uracil phosphoribosyltransferase; structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1a3c_A PYRR, pyrimidine operon regulatory protein PYRR; transcription regulation, attenuation protein, RNA-binding P pyrimidine biosynthesis; 1.60A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 1a4x_A 2igb_A* 1xz8_A* 1non_A 1xzn_A* Back     alignment and structure
>2geb_A Hypoxanthine-guanine phosphoribosyltransferase; HGPRT, mutant, inhibitor design, selectivity; 1.70A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>1hgx_A HGXPRTASE, hypoxanthine-guanine-xanthine phosphoribosyltransferase; glycosyltransferase, purine salvage, transferase (glycosyltransferase); HET: 5GP; 1.90A {Tritrichomonas foetus} SCOP: c.61.1.1 Back     alignment and structure
>1ao0_A Glutamine phosphoribosylpyrophosphate amidotransferase; glutamine amidotransferase, prtase, purine biosynthesis, phosphoribosyltransferase; HET: 5GP ADP; 2.80A {Bacillus subtilis} SCOP: c.61.1.1 d.153.1.1 PDB: 1gph_1* Back     alignment and structure
>1ufr_A TT1027, PYR mRNA-binding attenuation protein; pyrimidine nucleotide biosynthesis, transcriptional attenuation, RNA-binding protein; 2.60A {Thermus thermophilus} SCOP: c.61.1.1 Back     alignment and structure
>1yfz_A Hypoxanthine-guanine phosphoribosyltransferase; protein-nucleotide complex; HET: IMP; 2.20A {Thermoanaerobacter tengcongensis} SCOP: c.61.1.1 PDB: 1r3u_A* Back     alignment and structure
>1g2q_A Adenine phosphoribosyltransferase 1; dimer, single domain, catalytic loop; 1.50A {Saccharomyces cerevisiae} SCOP: c.61.1.1 PDB: 1g2p_A Back     alignment and structure
>1tc1_A Protein (hypoxanthine phosphoribosyltransferase); transferase,phosphoribosyltransferase, purine salvage, nucleotide metabolism; HET: FMB MES; 1.41A {Trypanosoma cruzi} SCOP: c.61.1.1 PDB: 1tc2_A* 1p19_A* 1p18_A* 1p17_A* 1i0l_A* 1i14_A* 1i0i_A* 1i13_A* Back     alignment and structure
>1pzm_A HGPRT, hypoxanthine-guanine phosphoribosyltransferase; HET: 5GP; 2.10A {Leishmania tarentolae} SCOP: c.61.1.1 Back     alignment and structure
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis} Back     alignment and structure
>1bd3_D Uprtase, uracil phosphoribosyltransferase; glycosyltransferase; 1.93A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1bd4_D 1jlr_A* 1jls_B* 1upf_D 1upu_D* Back     alignment and structure
>2jbh_A Phosphoribosyltransferase domain-containing prote; glycosyltransferase, purine salvage; HET: 5GP; 1.7A {Homo sapiens} Back     alignment and structure
>3ohp_A Hypoxanthine phosphoribosyltransferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.04A {Vibrio cholerae} SCOP: c.61.1.1 PDB: 1g9s_A* 1g9t_A* 1grv_A 1j7j_A Back     alignment and structure
>1fsg_A HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage; HET: PRP 9DG; 1.05A {Toxoplasma gondii} SCOP: c.61.1.1 PDB: 1qk3_A* 1qk4_A* 1qk5_A* 1dbr_A Back     alignment and structure
>3o7m_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, salvage of nucleosides and nucleotides; HET: GOL; 1.98A {Bacillus anthracis} SCOP: c.61.1.0 Back     alignment and structure
>3hvu_A Hypoxanthine phosphoribosyltransferase; hypoxanthine-guanine phosphoribosyltransferase, 2-(N-morphol ethanesulfonic acid (MES), IDP01892; HET: MES; 1.95A {Bacillus anthracis str} PDB: 3h83_A* 3kb8_A* Back     alignment and structure
>2ps1_A Orotate phosphoribosyltransferase 1; alpha beta, oprtase-OA-PRPP complex; HET: ORO PRP; 1.75A {Saccharomyces cerevisiae} PDB: 2pry_A* 2prz_A* Back     alignment and structure
>1w30_A PYRR bifunctional protein; transferase, glycosyltransferase, PSI, protein structure initiative, TB structural genomics consortium, TB; 1.9A {Mycobacterium tuberculosis} SCOP: c.61.1.1 Back     alignment and structure
>1z7g_A HGPRT, HGPRTASE, hypoxanthine-guanine phosphoribosyltransferase; flexibility, trans CIS peptide bond isomerization, nucleotide binding; 1.90A {Homo sapiens} SCOP: c.61.1.1 PDB: 1hmp_A* 1bzy_A 3gep_A* 3ggc_A* 3ggj_A* 1d6n_A* 2vfa_A* Back     alignment and structure
>3qw4_B UMP synthase; N-terminal orotidine monophosphate decarboxylase domain C-TE orotate phosphoribosyltransferase domain, transferase, LYAS; HET: U5P; 3.00A {Leishmania donovani} Back     alignment and structure
>3dmp_A Uracil phosphoribosyltransferase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.60A {Burkholderia pseudomallei} SCOP: c.61.1.1 Back     alignment and structure
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A Back     alignment and structure
>3ozf_A Hypoxanthine-guanine-xanthine phosphoribosyltrans; transferase-transferase inhibitor complex; HET: HPA; 1.94A {Plasmodium falciparum fcr-3} PDB: 3ozg_A* 1cjb_A* Back     alignment and structure
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae} Back     alignment and structure
>3acd_A Hypoxanthine-guanine phosphoribosyltransferase; rossmann fold, structural genomics, NPPSFA; HET: IMP; 1.89A {Thermus thermophilus} PDB: 3acc_A* 3acb_A* Back     alignment and structure
>2xbu_A Hypoxanthine-guanine phosphoribosyltransferase; glycosyltransferase, purine salvage, FLIP pepti; HET: 5GP; 1.80A {Saccharomyces cerevisiae} PDB: 2jkz_A* 2jky_A* Back     alignment and structure
>1xtt_A Probable uracil phosphoribosyltransferase; tetramer, type 1 phosphoribosyltransferase, UMP complex; HET: U5P; 1.80A {Sulfolobus solfataricus} SCOP: c.61.1.1 PDB: 1vst_A* 1xtu_A* 1xtv_A* 3g6w_A* Back     alignment and structure
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A* Back     alignment and structure
>1dqn_A Guanine phosphoribosyltransferase; protein-inhibitor complex, Mg IONS, pyrophosphate, transition state analogue; HET: IMU; 1.75A {Giardia intestinalis} SCOP: c.61.1.1 PDB: 1dqp_A* Back     alignment and structure
>1nul_A XPRT, xanthine-guanine phosphoribosyltransferase; purine salvage enzym; 1.80A {Escherichia coli} SCOP: c.61.1.1 PDB: 1a96_A* 1a95_A 1a98_A 1a97_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 84
d2c4ka2184 c.61.1.2 (A:167-350) PRPP synthetase-associated pr 1e-11
d1dkua2149 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate s 2e-09
d1u9ya2129 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate s 1e-05
d1i5ea_208 c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldoly 0.003
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 184 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosylpyrophosphate synthetase-like
domain: PRPP synthetase-associated protein 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 55.1 bits (132), Expect = 1e-11
 Identities = 57/82 (69%), Positives = 72/82 (87%)

Query: 1   MEMDVGVPQHPAKEKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVL 60
           +   + +P   AKEKPPI+VVGDVGGR+AI+VDD++DDV SFVAAAE+LK+RGAYKIYV+
Sbjct: 58  VHPGLELPLMMAKEKPPITVVGDVGGRIAIIVDDIIDDVESFVAAAEILKERGAYKIYVM 117

Query: 61  ATHGLLSSDAPLLIEESPIDEV 82
           ATHG+LS++AP LIEES +DEV
Sbjct: 118 ATHGILSAEAPRLIEESSVDEV 139
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Length = 149 Back     information, alignment and structure
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Length = 129 Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query84
d1u9ya2129 Phosphoribosylpyrophosphate synthetase {Methanocal 99.88
d1dkua2149 Phosphoribosylpyrophosphate synthetase {Bacillus s 99.87
d2c4ka2184 PRPP synthetase-associated protein 1 {Human (Homo 99.86
d1wd5a_208 Putative phosphoribosyltransferase TT1426 (TTHA146 99.42
d1vdma1153 Pprobable purine phosphoribosyltransferase PH0095 99.1
d2aeea1208 Orotate PRTase {Streptococcus pyogenes [TaxId: 131 99.05
d1zn7a1178 Adenine PRTase {Human (Homo sapiens) [TaxId: 9606] 99.03
d1qb7a_236 Adenine PRTase {Leishmania donovani [TaxId: 5661]} 99.02
d1y0ba1191 Xanthine phosphoribosyltransferase {Bacillus subti 99.02
d1l1qa_181 Adenine PRTase {Giardia lamblia [TaxId: 5741]} 99.0
d1tc1a_184 Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 569 98.94
d1g2qa_178 Adenine PRTase {Baker's yeast (Saccharomyces cerev 98.94
d1yfza1178 Xanthine-guanine PRTase (XPRTase) {Thermoanaerobac 98.94
d1pzma_183 Hypoxanthine-guanine-xanthine PRTase {Leishmania t 98.93
d1z7ga1214 Hypoxanthine-guanine PRTase (HGPRTase) {Human (Hom 98.92
d1vcha1174 Putative phosphoribosyltransferase TTHA1613 {Therm 98.92
d1j7ja_172 Hypoxanthine PRTase {Salmonella typhimurium [TaxId 98.88
d1cjba_228 Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium 98.87
d1hgxa_173 Hypoxanthine-guanine-xanthine PRTase {Tritrichomon 98.86
d1ufra_178 Pyrimidine operon regulator PyrR {Thermus thermoph 98.85
d1fsga_233 Hypoxanthine-guanine-xanthine PRTase {Toxoplasma g 98.82
d1i5ea_208 Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 98.81
d1lh0a_213 Orotate PRTase {Salmonella typhimurium [TaxId: 903 98.81
d1a3ca_178 Pyrimidine operon regulator PyrR {Bacillus subtili 98.8
d1w30a_182 Pyrimidine operon regulator PyrR {Mycobacterium tu 98.79
d1v9sa1208 Uracil PRTase, Upp {Thermus thermophilus [TaxId: 2 98.75
d1o5oa_210 Uracil PRTase, Upp {Thermotoga maritima [TaxId: 23 98.74
d1bd3a_224 Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811 98.66
d1o57a2202 Pur operon repressor (PurR), C-terminal domain {Ba 98.66
d1dqna_230 Guanine PRTase {Giardia lamblia [TaxId: 5741]} 98.47
d1xtta1215 Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId 98.44
d1gph11231 Glutamine PRPP amidotransferase, C-terminal domain 98.32
d1ecfa1243 Glutamine PRPP amidotransferase, C-terminal domain 98.17
d1nula_150 Xanthine-guanine PRTase (XPRTase) {Escherichia col 98.1
d1dcfa_134 Receiver domain of the ethylene receptor {Thale cr 84.97
d2c4ka1160 PRPP synthetase-associated protein 1 {Human (Homo 81.94
d1u0sy_118 CheY protein {Thermotoga maritima [TaxId: 2336]} 80.33
>d1u9ya2 c.61.1.2 (A:156-284) Phosphoribosylpyrophosphate synthetase {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PRTase-like
superfamily: PRTase-like
family: Phosphoribosylpyrophosphate synthetase-like
domain: Phosphoribosylpyrophosphate synthetase
species: Methanocaldococcus jannaschii [TaxId: 2190]

Probab=99.88  E-value=2.6e-23  Score=133.72  Aligned_cols=78  Identities=26%  Similarity=0.308  Sum_probs=66.9

Q ss_pred             CCCCcc-cCC------CCCCeeeeccCCCCEEEEEeccccchHHHHHHHHHHHHcCCCeEEEEEEeccCCCCHHHHhhcC
Q psy15570          5 VGVPQH-PAK------EKPPISVVGDVGGRVAIMVDDMVDDVHSFVAAAEVLKDRGAYKIYVLATHGLLSSDAPLLIEES   77 (84)
Q Consensus         5 ~~~~~~-~~~------~~~~~~i~g~v~gk~vlivDDii~TG~Tl~~~~~~L~~~ga~~v~~~~~h~~~s~~a~~~l~~~   77 (84)
                      +|.|+. ..+      +.+...+.|+++||+|+|+|||++||+|+..+++.|++.||++|++++||++|++++.++|.++
T Consensus        22 l~~~~a~~~K~R~~~~~~~~~~~~gdv~gk~viIvDDii~TGgTl~~aa~~Lk~~GA~~V~~~~tHgifs~~a~~~l~~~  101 (129)
T d1u9ya2          22 LNAEYDYLEKTRLSPTEIQIAPKTLDAKDRDVFIVDDIISTGGTMATAVKLLKEQGAKKIIAACVHPVLIGDALNKLYSA  101 (129)
T ss_dssp             HTCCEEEBC----------CCBSSCCCTTCCEEEEEEECSSSHHHHHHHHHHHHTTCCSEEEEEEECCCCTTHHHHHHHH
T ss_pred             cCCCEEEEEeeecccccceeecccccccceEEEEEcchhcccccHHHHHHHHHhcCCcceEEEEeccccChHHHHHHHhC
Confidence            467755 222      2334566789999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCcC
Q psy15570         78 PIDEV   82 (84)
Q Consensus        78 ~i~~i   82 (84)
                      +++++
T Consensus       102 ~i~~i  106 (129)
T d1u9ya2         102 GVEEV  106 (129)
T ss_dssp             TCSEE
T ss_pred             CCCEE
Confidence            99875
>d1dkua2 c.61.1.2 (A:167-315) Phosphoribosylpyrophosphate synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c4ka2 c.61.1.2 (A:167-350) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wd5a_ c.61.1.1 (A:) Putative phosphoribosyltransferase TT1426 (TTHA1462) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine phosphoribosyltransferase PH0095 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2aeea1 c.61.1.1 (A:1-208) Orotate PRTase {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1zn7a1 c.61.1.1 (A:3-180) Adenine PRTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qb7a_ c.61.1.1 (A:) Adenine PRTase {Leishmania donovani [TaxId: 5661]} Back     information, alignment and structure
>d1y0ba1 c.61.1.1 (A:1-191) Xanthine phosphoribosyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1l1qa_ c.61.1.1 (A:) Adenine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1tc1a_ c.61.1.1 (A:) Hypoxanthine PRTase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1g2qa_ c.61.1.1 (A:) Adenine PRTase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfza1 c.61.1.1 (A:3-180) Xanthine-guanine PRTase (XPRTase) {Thermoanaerobacter tengcongensis [TaxId: 119072]} Back     information, alignment and structure
>d1pzma_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Leishmania tarentolae [TaxId: 5689]} Back     information, alignment and structure
>d1z7ga1 c.61.1.1 (A:4-217) Hypoxanthine-guanine PRTase (HGPRTase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcha1 c.61.1.1 (A:2-175) Putative phosphoribosyltransferase TTHA1613 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1j7ja_ c.61.1.1 (A:) Hypoxanthine PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cjba_ c.61.1.1 (A:) Hypoxanthine-guanine PRTase (HGPRTase) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hgxa_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Tritrichomonas foetus [TaxId: 5724]} Back     information, alignment and structure
>d1ufra_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fsga_ c.61.1.1 (A:) Hypoxanthine-guanine-xanthine PRTase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1i5ea_ c.61.1.1 (A:) Uracil PRTase, Upp {Bacillus caldolyticus [TaxId: 1394]} Back     information, alignment and structure
>d1lh0a_ c.61.1.1 (A:) Orotate PRTase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a3ca_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1w30a_ c.61.1.1 (A:) Pyrimidine operon regulator PyrR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1v9sa1 c.61.1.1 (A:1-208) Uracil PRTase, Upp {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o5oa_ c.61.1.1 (A:) Uracil PRTase, Upp {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bd3a_ c.61.1.1 (A:) Uracil PRTase, Upp {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1o57a2 c.61.1.1 (A:75-276) Pur operon repressor (PurR), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dqna_ c.61.1.1 (A:) Guanine PRTase {Giardia lamblia [TaxId: 5741]} Back     information, alignment and structure
>d1xtta1 c.61.1.1 (A:2-216) Uracil PRTase, Upp {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1gph11 c.61.1.1 (1:235-465) Glutamine PRPP amidotransferase, C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ecfa1 c.61.1.1 (A:250-492) Glutamine PRPP amidotransferase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nula_ c.61.1.1 (A:) Xanthine-guanine PRTase (XPRTase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dcfa_ c.23.1.2 (A:) Receiver domain of the ethylene receptor {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c4ka1 c.61.1.2 (A:7-166) PRPP synthetase-associated protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u0sy_ c.23.1.1 (Y:) CheY protein {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure