Diaphorina citri psyllid: psy15576


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MNKWLRNSNHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
ccccccccccccccccccccccccccccccccccccccccccccccEEcccEEEEEHHHHHHHHHcccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHcc
********NHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKWLRNSNHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Electron transfer flavoprotein subunit alpha, mitochondrial The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).very confidentQ99LC5
Electron transfer flavoprotein subunit alpha, mitochondrial The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).very confidentQ5RC31
Electron transfer flavoprotein subunit alpha, mitochondrial The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).very confidentP13804

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005739 [CC]mitochondrionconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016491 [MF]oxidoreductase activityconfidentGO:0003824, GO:0003674
GO:0050660 [MF]flavin adenine dinucleotide bindingconfidentGO:0043168, GO:0050662, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0005811 [CC]lipid particleconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009055 [MF]electron carrier activityconfidentGO:0003674
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0022904 [BP]respiratory electron transport chainprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0022900, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0007443 [BP]Malpighian tubule morphogenesisprobableGO:0032502, GO:0061326, GO:0048619, GO:0055123, GO:0009790, GO:0048565, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0048513, GO:0048729, GO:0060562, GO:0048598, GO:0061333, GO:0032501, GO:0035239, GO:0060429, GO:0009888, GO:0044767, GO:0061525, GO:0008150, GO:0001655, GO:0072002, GO:0072001, GO:0007442, GO:0044707, GO:0048856, GO:0035295, GO:0048731, GO:0048546
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0048567 [BP]ectodermal digestive tract morphogenesisprobableGO:0032502, GO:0055123, GO:0032501, GO:0048565, GO:0044707, GO:0048856, GO:0009888, GO:0007439, GO:0044767, GO:0008150, GO:0048729, GO:0007275, GO:0048731, GO:0009653, GO:0048546, GO:0044699
GO:0008258 [BP]head involutionprobableGO:0048598, GO:0032502, GO:0001700, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0007424 [BP]open tracheal system developmentprobableGO:0060541, GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005507 [MF]copper ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0017133 [CC]mitochondrial electron transfer flavoprotein complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0005739, GO:0005759, GO:0043231, GO:0043234, GO:0032991, GO:0045251, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005618 [CC]cell wallprobableGO:0005575, GO:0071944, GO:0044464, GO:0005623, GO:0030312
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0006119 [BP]oxidative phosphorylationprobableGO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0006091
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EFP, chain A
Confidence level:very confident
Coverage over the Query: 6-108
View the alignment between query and template
View the model in PyMOL