Psyllid ID: psy15576


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MNKWLRNSNHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
ccccccccccccccccccccccccccccccccccccccccccccccEEcccEEEEEHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHcc
ccccccccccEEEEEcccHHHHHccccccccccccccccEccccccEccccEEEEEcccccHHHHcccccccEEEEEEcccccHHHHcccEEEEccHHHHHHHHHHHc
mnkwlrnsnHKVLQITQTynsfsqphypkLLTVQIAETYISALKASQLIPELYIAVGISGAIQHlagmkdsktivainkdpeapifqvsdygLVADLFKAVPELTEKL
mnkwlrnsnHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
MNKWLRNSNHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
*********HKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAV*******
********NHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
********NHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
***WLRNSNHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKWLRNSNHKVLQITQTYNSFSQPHYPKLLTVQIAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query108 2.2.26 [Sep-21-2011]
P13804333 Electron transfer flavopr yes N/A 0.546 0.177 0.915 5e-26
Q2KJE4333 Electron transfer flavopr yes N/A 0.546 0.177 0.915 5e-26
Q99LC5333 Electron transfer flavopr yes N/A 0.546 0.177 0.915 2e-25
P13803333 Electron transfer flavopr yes N/A 0.546 0.177 0.915 3e-25
Q5RC31333 Electron transfer flavopr yes N/A 0.546 0.177 0.915 4e-25
Q8HXY0333 Electron transfer flavopr N/A N/A 0.546 0.177 0.915 4e-25
Q93615332 Probable electron transfe yes N/A 0.546 0.177 0.864 6e-24
Q54FD7355 Electron transfer flavopr yes N/A 0.546 0.166 0.847 1e-23
P38974308 Electron transfer flavopr yes N/A 0.546 0.191 0.847 1e-23
P53573314 Electron transfer flavopr yes N/A 0.546 0.187 0.847 2e-23
>sp|P13804|ETFA_HUMAN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens GN=ETFA PE=1 SV=1 Back     alignment and function desciption
 Score =  116 bits (290), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 54/59 (91%), Positives = 57/59 (96%)

Query: 50  PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL 108
           PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQV+DYG+VADLFK VPE+TE L
Sbjct: 272 PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEIL 330




The electron transfer flavoprotein serves as a specific electron acceptor for several dehydrogenases, including five acyl-CoA dehydrogenases, glutaryl-CoA and sarcosine dehydrogenase. It transfers the electrons to the main mitochondrial respiratory chain via ETF-ubiquinone oxidoreductase (ETF dehydrogenase).
Homo sapiens (taxid: 9606)
>sp|Q2KJE4|ETFA_BOVIN Electron transfer flavoprotein subunit alpha, mitochondrial OS=Bos taurus GN=ETFA PE=2 SV=1 Back     alignment and function description
>sp|Q99LC5|ETFA_MOUSE Electron transfer flavoprotein subunit alpha, mitochondrial OS=Mus musculus GN=Etfa PE=1 SV=2 Back     alignment and function description
>sp|P13803|ETFA_RAT Electron transfer flavoprotein subunit alpha, mitochondrial OS=Rattus norvegicus GN=Etfa PE=1 SV=4 Back     alignment and function description
>sp|Q5RC31|ETFA_PONAB Electron transfer flavoprotein subunit alpha, mitochondrial OS=Pongo abelii GN=ETFA PE=2 SV=1 Back     alignment and function description
>sp|Q8HXY0|ETFA_MACFA Electron transfer flavoprotein subunit alpha, mitochondrial OS=Macaca fascicularis GN=ETFA PE=2 SV=1 Back     alignment and function description
>sp|Q93615|ETFA_CAEEL Probable electron transfer flavoprotein subunit alpha, mitochondrial OS=Caenorhabditis elegans GN=F27D4.1 PE=3 SV=2 Back     alignment and function description
>sp|Q54FD7|ETFA_DICDI Electron transfer flavoprotein subunit alpha, mitochondrial OS=Dictyostelium discoideum GN=etfa PE=3 SV=1 Back     alignment and function description
>sp|P38974|ETFA_PARDE Electron transfer flavoprotein subunit alpha OS=Paracoccus denitrificans GN=etfA PE=1 SV=2 Back     alignment and function description
>sp|P53573|ETFA_BRAJA Electron transfer flavoprotein subunit alpha OS=Bradyrhizobium japonicum (strain USDA 110) GN=etfA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
328773160 344 hypothetical protein BATDEDRAFT_18359 [B 0.564 0.177 0.934 3e-26
322800073 333 hypothetical protein SINV_07965 [Solenop 0.546 0.177 0.966 5e-26
383849593 333 PREDICTED: electron transfer flavoprotei 0.546 0.177 0.966 5e-26
225706994 334 Electron transfer flavoprotein subunit a 0.546 0.176 0.966 7e-26
332019963 320 Electron transfer flavoprotein subunit a 0.546 0.184 0.966 7e-26
340727666 333 PREDICTED: electron transfer flavoprotei 0.546 0.177 0.966 7e-26
350423629 333 PREDICTED: electron transfer flavoprotei 0.546 0.177 0.966 9e-26
66526470 333 PREDICTED: electron transfer flavoprotei 0.546 0.177 0.966 9e-26
380028311 310 PREDICTED: electron transfer flavoprotei 0.546 0.190 0.966 1e-25
348505842 333 PREDICTED: electron transfer flavoprotei 0.546 0.177 0.949 1e-25
>gi|328773160|gb|EGF83197.1| hypothetical protein BATDEDRAFT_18359 [Batrachochytrium dendrobatidis JAM81] Back     alignment and taxonomy information
 Score =  122 bits (306), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 57/61 (93%), Positives = 60/61 (98%)

Query: 48  LIPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEK 107
           + PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKA+PELTEK
Sbjct: 282 IAPELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAIPELTEK 341

Query: 108 L 108
           +
Sbjct: 342 I 342




Source: Batrachochytrium dendrobatidis JAM81

Species: Batrachochytrium dendrobatidis

Genus: Batrachochytrium

Family:

Order: Rhizophydiales

Class: Chytridiomycetes

Phylum: Chytridiomycota

Superkingdom: Eukaryota

>gi|322800073|gb|EFZ21179.1| hypothetical protein SINV_07965 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383849593|ref|XP_003700429.1| PREDICTED: electron transfer flavoprotein subunit alpha, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|225706994|gb|ACO09343.1| Electron transfer flavoprotein subunit alpha, mitochondrial precursor [Osmerus mordax] Back     alignment and taxonomy information
>gi|332019963|gb|EGI60423.1| Electron transfer flavoprotein subunit alpha, mitochondrial [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340727666|ref|XP_003402160.1| PREDICTED: electron transfer flavoprotein subunit alpha, mitochondrial-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350423629|ref|XP_003493541.1| PREDICTED: electron transfer flavoprotein subunit alpha, mitochondrial-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66526470|ref|XP_624102.1| PREDICTED: electron transfer flavoprotein subunit alpha, mitochondrial-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380028311|ref|XP_003697849.1| PREDICTED: electron transfer flavoprotein subunit alpha, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|348505842|ref|XP_003440469.1| PREDICTED: electron transfer flavoprotein subunit alpha, mitochondrial-like [Oreochromis niloticus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query108
ZFIN|ZDB-GENE-030131-4449339 etfa "electron-transfer-flavop 0.546 0.174 0.949 1.2e-24
UNIPROTKB|E1BZW5323 ETFA "Uncharacterized protein" 0.546 0.182 0.932 2.6e-24
UNIPROTKB|F1MWR3333 ETFA "Electron transfer flavop 0.546 0.177 0.915 4.2e-24
UNIPROTKB|Q2KJE4333 ETFA "Electron transfer flavop 0.546 0.177 0.915 4.2e-24
UNIPROTKB|E2RAE2333 ETFA "Uncharacterized protein" 0.546 0.177 0.915 4.2e-24
UNIPROTKB|F1SJX1333 ETFA "Uncharacterized protein" 0.546 0.177 0.915 4.2e-24
UNIPROTKB|H0YK49229 ETFA "Electron transfer flavop 0.546 0.257 0.915 5.3e-24
UNIPROTKB|H0YL8373 ETFA "Electron transfer flavop 0.546 0.808 0.915 5.3e-24
UNIPROTKB|P13804333 ETFA "Electron transfer flavop 0.546 0.177 0.915 5.3e-24
MGI|MGI:106092333 Etfa "electron transferring fl 0.546 0.177 0.915 5.3e-24
ZFIN|ZDB-GENE-030131-4449 etfa "electron-transfer-flavoprotein, alpha polypeptide" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 281 (104.0 bits), Expect = 1.2e-24, P = 1.2e-24
 Identities = 56/59 (94%), Positives = 57/59 (96%)

Query:    50 PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL 108
             PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQV+DYGLVADLFK VPELTE L
Sbjct:   273 PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGLVADLFKVVPELTEAL 331




GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
UNIPROTKB|E1BZW5 ETFA "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MWR3 ETFA "Electron transfer flavoprotein subunit alpha, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJE4 ETFA "Electron transfer flavoprotein subunit alpha, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAE2 ETFA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SJX1 ETFA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H0YK49 ETFA "Electron transfer flavoprotein subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YL83 ETFA "Electron transfer flavoprotein subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P13804 ETFA "Electron transfer flavoprotein subunit alpha, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:106092 Etfa "electron transferring flavoprotein, alpha polypeptide" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B7UI88FIXB_ECO27No assigned EC number0.62290.56480.1948yesN/A
B7L4G5FIXB_ECO55No assigned EC number0.62290.56480.1948yesN/A
Q75LJ3ETFA_ORYSJNo assigned EC number0.72880.54620.1648yesN/A
Q99LC5ETFA_MOUSENo assigned EC number0.91520.54620.1771yesN/A
B6HYZ3FIXB_ECOSENo assigned EC number0.62290.56480.1948yesN/A
B7M0D9FIXB_ECO8ANo assigned EC number0.62290.56480.1948yesN/A
P71153ETFA_THETCNo assigned EC number0.69490.54620.1787yesN/A
Q5Y223ETFA_CRYGWNo assigned EC number0.76270.54620.1705yesN/A
Q32K55FIXB_SHIDSNo assigned EC number0.62290.56480.1948yesN/A
B5YYD6FIXB_ECO5ENo assigned EC number0.62290.56480.1948yesN/A
B1IRD4FIXB_ECOLCNo assigned EC number0.62290.56480.1948yesN/A
Q8HXY0ETFA_MACFANo assigned EC number0.91520.54620.1771N/AN/A
A7ZVZ4FIXB_ECOHSNo assigned EC number0.62290.56480.1948yesN/A
B1XBG7FIXB_ECODHNo assigned EC number0.62290.56480.1948yesN/A
B7NHE6FIXB_ECO7INo assigned EC number0.62290.56480.1948yesN/A
Q9HZP7ETFA_PSEAENo assigned EC number0.84740.54620.1909yesN/A
B7MNP9FIXB_ECO81No assigned EC number0.62290.56480.1948yesN/A
Q0TLU7FIXB_ECOL5No assigned EC number0.62290.56480.1948yesN/A
A1A792FIXB_ECOK1No assigned EC number0.62290.56480.1948yesN/A
Q3Z5W6FIXB_SHISSNo assigned EC number0.62290.56480.1948yesN/A
C4ZPW8FIXB_ECOBWNo assigned EC number0.62290.56480.1948yesN/A
O53275ETFA_MYCTUNo assigned EC number0.71180.54620.1855yesN/A
Q1RGF6FIXB_ECOUTNo assigned EC number0.62290.56480.1948yesN/A
O85692ETFA_MEGELNo assigned EC number0.62710.54620.1745yesN/A
P78790ETFA_SCHPONo assigned EC number0.72130.56480.1788yesN/A
Q9C6I6ETFA_ARATHNo assigned EC number0.76270.54620.1625yesN/A
P52039ETFA_CLOABNo assigned EC number0.64400.54620.1755yesN/A
P59675FIXB_SHIFLNo assigned EC number0.62290.56480.1948yesN/A
P59674FIXB_ECOL6No assigned EC number0.62290.56480.1948yesN/A
Q93615ETFA_CAEELNo assigned EC number0.86440.54620.1777yesN/A
Q54FD7ETFA_DICDINo assigned EC number0.84740.54620.1661yesN/A
Q5RC31ETFA_PONABNo assigned EC number0.91520.54620.1771yesN/A
P0CN60ETFA_CRYNJNo assigned EC number0.74570.54620.1705yesN/A
P94551ETFA_BACSUNo assigned EC number0.70490.56480.1876yesN/A
B7N7R7FIXB_ECOLUNo assigned EC number0.62290.56480.1948yesN/A
P38974ETFA_PARDENo assigned EC number0.84740.54620.1915yesN/A
P13804ETFA_HUMANNo assigned EC number0.91520.54620.1771yesN/A
Q2KJE4ETFA_BOVINNo assigned EC number0.91520.54620.1771yesN/A
P13803ETFA_RATNo assigned EC number0.91520.54620.1771yesN/A
B7MAG5FIXB_ECO45No assigned EC number0.62290.56480.1948yesN/A
Q12480ETFA_YEASTNo assigned EC number0.77960.54620.1715yesN/A
P53573ETFA_BRAJANo assigned EC number0.84740.54620.1878yesN/A
O33096ETFA_MYCLENo assigned EC number0.67790.54620.1855yesN/A
B1LFX6FIXB_ECOSMNo assigned EC number0.62290.56480.1948yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
COG2025313 COG2025, FixB, Electron transfer flavoprotein, alp 6e-40
PLN00022356 PLN00022, PLN00022, electron transfer flavoprotein 4e-39
PRK03363313 PRK03363, fixB, putative electron transfer flavopr 2e-21
PRK11916312 PRK11916, PRK11916, electron transfer flavoprotein 9e-20
pfam0076686 pfam00766, ETF_alpha, Electron transfer flavoprote 9e-13
>gnl|CDD|224936 COG2025, FixB, Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
 Score =  134 bits (339), Expect = 6e-40
 Identities = 48/59 (81%), Positives = 52/59 (88%)

Query: 50  PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL 108
           P+LYIA+GISGAIQHLAGMKDSK IVAINKDP APIFQV+DYG+V DLFK VP L E L
Sbjct: 252 PKLYIALGISGAIQHLAGMKDSKVIVAINKDPNAPIFQVADYGIVGDLFKIVPALIEAL 310


Length = 313

>gnl|CDD|215032 PLN00022, PLN00022, electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|235120 PRK03363, fixB, putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>gnl|CDD|183380 PRK11916, PRK11916, electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>gnl|CDD|189709 pfam00766, ETF_alpha, Electron transfer flavoprotein FAD-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 108
COG2025313 FixB Electron transfer flavoprotein, alpha subunit 100.0
KOG3954|consensus336 100.0
PRK03363313 fixB putative electron transfer flavoprotein FixB; 100.0
PRK11916312 electron transfer flavoprotein subunit YdiR; Provi 100.0
PLN00022356 electron transfer flavoprotein subunit alpha; Prov 100.0
PF0076686 ETF_alpha: Electron transfer flavoprotein FAD-bind 99.87
cd01408235 SIRT1 SIRT1: Eukaryotic group (class1) which inclu 95.91
PTZ00408242 NAD-dependent deacetylase; Provisional 95.44
PRK14138244 NAD-dependent deacetylase; Provisional 95.43
PRK00481242 NAD-dependent deacetylase; Provisional 95.42
cd01412224 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaea 93.58
PRK05333285 NAD-dependent deacetylase; Provisional 93.04
PF00205137 TPP_enzyme_M: Thiamine pyrophosphate enzyme, centr 90.76
PRK06466 574 acetolactate synthase 3 catalytic subunit; Validat 90.46
TIGR00118 558 acolac_lg acetolactate synthase, large subunit, bi 89.45
PRK06546 578 pyruvate dehydrogenase; Provisional 89.35
COG0846250 SIR2 NAD-dependent protein deacetylases, SIR2 fami 89.05
PRK08978 548 acetolactate synthase 2 catalytic subunit; Reviewe 87.79
PRK07418 616 acetolactate synthase 3 catalytic subunit; Reviewe 87.07
PRK07524 535 hypothetical protein; Provisional 87.01
PRK07282 566 acetolactate synthase catalytic subunit; Reviewed 86.86
TIGR00173432 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohex 86.79
PTZ00409271 Sir2 (Silent Information Regulator) protein; Provi 86.79
TIGR01504 588 glyox_carbo_lig glyoxylate carboligase. Glyoxylate 86.54
PRK07789 612 acetolactate synthase 1 catalytic subunit; Validat 86.39
PRK08322 547 acetolactate synthase; Reviewed 85.94
PRK06112 578 acetolactate synthase catalytic subunit; Validated 85.55
PRK07979 574 acetolactate synthase 3 catalytic subunit; Validat 84.97
CHL00099 585 ilvB acetohydroxyacid synthase large subunit 84.2
PRK08527 563 acetolactate synthase 3 catalytic subunit; Validat 82.35
PRK06725 570 acetolactate synthase 3 catalytic subunit; Validat 81.96
cd01409260 SIRT4 SIRT4: Eukaryotic and prokaryotic group (cla 81.38
PRK08327 569 acetolactate synthase catalytic subunit; Validated 80.82
PRK08266 542 hypothetical protein; Provisional 80.82
PRK06154 565 hypothetical protein; Provisional 80.75
>COG2025 FixB Electron transfer flavoprotein, alpha subunit [Energy production and conversion] Back     alignment and domain information
Probab=100.00  E-value=2.2e-46  Score=305.14  Aligned_cols=104  Identities=49%  Similarity=0.691  Sum_probs=95.1

Q ss_pred             ceeecCCccccccccccccccccchhhhhhc-----------cccceeeeccCeeeCcceEEeeccchhhHhhhccCCCC
Q psy15576          4 WLRNSNHKVLQITQTYNSFSQPHYPKLLTVQ-----------IAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSK   72 (108)
Q Consensus         4 ~~~~s~~r~~~~~~~~~~~~~pva~kL~a~~-----------i~~~~igg~SGktV~P~lYia~GISGA~QH~~Gm~~s~   72 (108)
                      +.=+|||||+++.|||+. +.|+||+||+..           ++++++.|+|||+|+|+||||||||||+||++||++||
T Consensus       196 ~iVVsgGRG~gs~enf~~-i~~LA~~LGa~VGaSRp~vd~gw~p~d~QVGqTGk~V~P~LYIA~GISGAiQHlaGm~~Sk  274 (313)
T COG2025         196 KIVVSGGRGLGSKENFKL-LEELADVLGAAVGASRPAVDAGWMPNDRQVGQTGKTVAPKLYIALGISGAIQHLAGMKDSK  274 (313)
T ss_pred             eEEEEcCcccCChhhhHH-HHHHHHHhCceeeccHHHHhcCCCCccceecCCCcEecccEEEEEecccHHHHHhhcccCc
Confidence            345899999999999966 799999999982           44444455999999999999999999999999999999


Q ss_pred             eEEEecCCCCCCcccccCeeEeeeHHHHHHHHHhhC
Q psy15576         73 TIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL  108 (108)
Q Consensus        73 ~IIAIN~Dp~ApIf~~ADygiVgD~~evlp~Li~~l  108 (108)
                      +|||||+|||||||++||||||||+++++|+|+++|
T Consensus       275 ~IVAINkD~nAPIF~~ADyGiVgDl~~ivP~Lie~l  310 (313)
T COG2025         275 VIVAINKDPNAPIFQVADYGIVGDLFKIVPALIEAL  310 (313)
T ss_pred             EEEEEcCCCCCCccccCCeeeeeeHHHHHHHHHHHH
Confidence            999999999999999999999999999999999975



>KOG3954|consensus Back     alignment and domain information
>PRK03363 fixB putative electron transfer flavoprotein FixB; Provisional Back     alignment and domain information
>PRK11916 electron transfer flavoprotein subunit YdiR; Provisional Back     alignment and domain information
>PLN00022 electron transfer flavoprotein subunit alpha; Provisional Back     alignment and domain information
>PF00766 ETF_alpha: Electron transfer flavoprotein FAD-binding domain; InterPro: IPR014731 Electron transfer flavoproteins (ETFs) serve as specific electron acceptors for primary dehydrogenases, transferring the electrons to terminal respiratory systems Back     alignment and domain information
>cd01408 SIRT1 SIRT1: Eukaryotic group (class1) which includes human sirtuins SIRT1-3 and yeast Hst1-4; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PTZ00408 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK14138 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PRK00481 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>cd01412 SIRT5_Af1_CobB SIRT5_Af1_CobB: Eukaryotic, archaeal and prokaryotic group (class3) which includes human sirtuin SIRT5, Archaeoglobus fulgidus Sir2-Af1, and E Back     alignment and domain information
>PRK05333 NAD-dependent deacetylase; Provisional Back     alignment and domain information
>PF00205 TPP_enzyme_M: Thiamine pyrophosphate enzyme, central domain; InterPro: IPR012000 A number of enzymes require thiamine pyrophosphate (TPP) (vitamin B1) as a cofactor Back     alignment and domain information
>PRK06466 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>TIGR00118 acolac_lg acetolactate synthase, large subunit, biosynthetic type Back     alignment and domain information
>PRK06546 pyruvate dehydrogenase; Provisional Back     alignment and domain information
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription] Back     alignment and domain information
>PRK08978 acetolactate synthase 2 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07418 acetolactate synthase 3 catalytic subunit; Reviewed Back     alignment and domain information
>PRK07524 hypothetical protein; Provisional Back     alignment and domain information
>PRK07282 acetolactate synthase catalytic subunit; Reviewed Back     alignment and domain information
>TIGR00173 menD 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase Back     alignment and domain information
>PTZ00409 Sir2 (Silent Information Regulator) protein; Provisional Back     alignment and domain information
>TIGR01504 glyox_carbo_lig glyoxylate carboligase Back     alignment and domain information
>PRK07789 acetolactate synthase 1 catalytic subunit; Validated Back     alignment and domain information
>PRK08322 acetolactate synthase; Reviewed Back     alignment and domain information
>PRK06112 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK07979 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>CHL00099 ilvB acetohydroxyacid synthase large subunit Back     alignment and domain information
>PRK08527 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>PRK06725 acetolactate synthase 3 catalytic subunit; Validated Back     alignment and domain information
>cd01409 SIRT4 SIRT4: Eukaryotic and prokaryotic group (class2) which includes human sirtuin SIRT4 and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation Back     alignment and domain information
>PRK08327 acetolactate synthase catalytic subunit; Validated Back     alignment and domain information
>PRK08266 hypothetical protein; Provisional Back     alignment and domain information
>PRK06154 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
1t9g_R333 Structure Of The Human Mcad:etf Complex Length = 33 4e-27
1efv_A315 Three-Dimensional Structure Of Human Electron Trans 4e-27
1efp_A307 Electron Transfer Flavoprotein (Etf) From Paracoccu 1e-24
3cls_D321 Crystal Structure Of The R236c Mutant Of Etf From M 2e-13
1o94_D320 Ternary Complex Between Trimethylamine Dehydrogenas 2e-13
3clu_D321 Crystal Structure Of The R236k Mutant From Methylop 2e-13
3clt_D321 Crystal Structure Of The R236e Mutant Of Methylophi 2e-13
3clr_D321 Crystal Structure Of The R236a Etf Mutant From M. M 2e-13
>pdb|1T9G|R Chain R, Structure Of The Human Mcad:etf Complex Length = 333 Back     alignment and structure

Iteration: 1

Score = 116 bits (290), Expect = 4e-27, Method: Compositional matrix adjust. Identities = 54/59 (91%), Positives = 57/59 (96%) Query: 50 PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL 108 PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQV+DYG+VADLFK VPE+TE L Sbjct: 272 PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEIL 330
>pdb|1EFV|A Chain A, Three-Dimensional Structure Of Human Electron Transfer Flavoprotein To 2.1 A Resolution Length = 315 Back     alignment and structure
>pdb|1EFP|A Chain A, Electron Transfer Flavoprotein (Etf) From Paracoccus Denitrificans Length = 307 Back     alignment and structure
>pdb|3CLS|D Chain D, Crystal Structure Of The R236c Mutant Of Etf From Methylophilus Methylotrophus Length = 321 Back     alignment and structure
>pdb|1O94|D Chain D, Ternary Complex Between Trimethylamine Dehydrogenase And Electron Transferring Flavoprotein Length = 320 Back     alignment and structure
>pdb|3CLU|D Chain D, Crystal Structure Of The R236k Mutant From Methylophilus Methylotrophus Etf Length = 321 Back     alignment and structure
>pdb|3CLT|D Chain D, Crystal Structure Of The R236e Mutant Of Methylophilus Methylotrophus Etf Length = 321 Back     alignment and structure
>pdb|3CLR|D Chain D, Crystal Structure Of The R236a Etf Mutant From M. Methylotrophus Length = 321 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query108
1efv_A315 Electron transfer flavoprotein; electron transport 2e-48
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 3e-48
1o97_D320 Electron transferring flavoprotein alpha-subunit; 9e-46
>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Length = 315 Back     alignment and structure
 Score =  155 bits (394), Expect = 2e-48
 Identities = 54/59 (91%), Positives = 57/59 (96%)

Query: 50  PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL 108
           PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQV+DYG+VADLFK VPE+TE L
Sbjct: 254 PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEIL 312


>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Length = 307 Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
1efp_A307 ETF, protein (electron transfer flavoprotein); ele 100.0
1efv_A315 Electron transfer flavoprotein; electron transport 100.0
1o97_D320 Electron transferring flavoprotein alpha-subunit; 100.0
1s5p_A235 NAD-dependent deacetylase; protein deacetylase, SI 96.54
1q1a_A289 HST2 protein; ternary complex, histone deacetylase 96.27
1yc5_A246 NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, 95.97
2hjh_A354 NAD-dependent histone deacetylase SIR2; protein, s 95.84
1ma3_A253 SIR2-AF2, transcriptional regulatory protein, SIR2 95.73
1q14_A361 HST2 protein; histone deacetylase, hydrolase; 2.50 95.63
1m2k_A249 Silent information regulator 2; protein-ligand com 95.59
3k35_A318 NAD-dependent deacetylase sirtuin-6; rossmann fold 95.32
1j8f_A323 SIRT2, sirtuin 2, isoform 1, silencing INFO; gene 95.23
3riy_A273 NAD-dependent deacetylase sirtuin-5; desuccinylase 95.21
3glr_A285 NAD-dependent deacetylase sirtuin-3, mitochondria; 95.15
3pki_A355 NAD-dependent deacetylase sirtuin-6; ADP ribose, s 94.88
4iao_A492 NAD-dependent histone deacetylase SIR2; protein co 94.57
3u31_A290 SIR2A, transcriptional regulatory protein SIR2 hom 93.63
3lq1_A 578 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 84.86
1ozh_A 566 ALS, acetolactate synthase, catabolic; acetohydrox 84.74
1q6z_A 528 BFD, BFDC, benzoylformate decarboxylase; lyase, ca 83.1
2x7j_A 604 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene - 81.33
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 80.92
3eya_A 549 Pyruvate dehydrogenase [cytochrome]; pyruvate oxid 80.43
>1efp_A ETF, protein (electron transfer flavoprotein); electron transport, glutaric acidemia type II; HET: FAD AMP; 2.60A {Paracoccus denitrificans} SCOP: c.26.2.3 c.31.1.2 Back     alignment and structure
Probab=100.00  E-value=7.9e-48  Score=307.13  Aligned_cols=102  Identities=53%  Similarity=0.749  Sum_probs=94.8

Q ss_pred             eecCCccccccccccccccccchhhhhhc-----------cccceeeeccCeeeCcceEEeeccchhhHhhhccCCCCeE
Q psy15576          6 RNSNHKVLQITQTYNSFSQPHYPKLLTVQ-----------IAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKTI   74 (108)
Q Consensus         6 ~~s~~r~~~~~~~~~~~~~pva~kL~a~~-----------i~~~~igg~SGktV~P~lYia~GISGA~QH~~Gm~~s~~I   74 (108)
                      =+||||||++.||| ++++++||+||++-           ++..++.|+|||+|+|+||||||||||+||++||++||+|
T Consensus       195 vVsgGRG~~~~e~f-~~~~~LA~~Lga~vgaSR~~vd~Gw~~~~~QVGqTGk~V~P~lYiA~GISGAiQHlaGm~~s~~I  273 (307)
T 1efp_A          195 VVSGGRGLGSKESF-AIIEELADKLGAAVGASRAAVDSGYAPNDWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKVI  273 (307)
T ss_dssp             EEEECGGGCSSSTT-HHHHHHHHHHTCEEEECHHHHHTTSSCGGGBBSSSSBCCCCSEEEEESCCCCHHHHTTTTTCSEE
T ss_pred             EEEcCCcCCCHHHH-HHHHHHHHHhCCceeecHHHHhCCCCChhhEeccCCcccCCceEEEEeccCcHHHHhhhccCCEE
Confidence            37999999999999 68899999999872           5555555599999999999999999999999999999999


Q ss_pred             EEecCCCCCCcccccCeeEeeeHHHHHHHHHhhC
Q psy15576         75 VAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL  108 (108)
Q Consensus        75 IAIN~Dp~ApIf~~ADygiVgD~~evlp~Li~~l  108 (108)
                      ||||+||+||||++||||||||++|++|+|+++|
T Consensus       274 VAIN~D~~ApIF~~ADygiVgDl~~v~P~L~~~l  307 (307)
T 1efp_A          274 VAINKDEEAPIFQIADYGLVGDLFSVVPELTGKL  307 (307)
T ss_dssp             EEEESCTTCGGGGTCSEEEESCHHHHHHHHHHTC
T ss_pred             EEEeCCCCCCcccccCeEEeeeHHHHHHHHHhhC
Confidence            9999999999999999999999999999999986



>1efv_A Electron transfer flavoprotein; electron transport, glutaric acidemia type II; HET: FAD AMP; 2.10A {Homo sapiens} SCOP: c.26.2.3 c.31.1.2 PDB: 2a1u_A* 1t9g_R* 2a1t_R* Back     alignment and structure
>1o97_D Electron transferring flavoprotein alpha-subunit; FAD binding; HET: AMP FAD; 1.6A {Methylophilus methylotrophus} SCOP: c.26.2.3 c.31.1.2 PDB: 1o95_D* 1o96_B* 1o94_D* 3clu_D* 3clt_D* 3clr_D* 3cls_D* Back     alignment and structure
>1s5p_A NAD-dependent deacetylase; protein deacetylase, SIR2 homologue, hydrolase; HET: ALY; 1.96A {Escherichia coli} SCOP: c.31.1.5 Back     alignment and structure
>1q1a_A HST2 protein; ternary complex, histone deacetylase, 2'-O-ADP ribose,, gene regulation; HET: ALY OAD; 1.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 PDB: 1szd_A* 1szc_A* 2od7_A* 2od9_A* 2qqf_A* 2qqg_A* 1q17_A* 2od2_A* Back     alignment and structure
>1yc5_A NAD-dependent deacetylase; SIR2, sirtuin, SIR2TM, SIRT1, nicotinamide, hydrolase; HET: ALY; 1.40A {Thermotoga maritima} SCOP: c.31.1.5 PDB: 2h2d_A* 2h2f_A 2h2g_A* 2h2h_A* 2h2i_A* 2h4f_A* 2h4j_A* 3d4b_A* 3d81_A* 3pdh_A* 2h4h_A* 3jr3_A* 2h59_A* Back     alignment and structure
>2hjh_A NAD-dependent histone deacetylase SIR2; protein, sirtuin, acetyl-ADP-ribose, nicotinamide, hydrolase; HET: XYQ; 1.85A {Saccharomyces cerevisiae} Back     alignment and structure
>1ma3_A SIR2-AF2, transcriptional regulatory protein, SIR2 family; enzyme-substrate complex, protein binding, transcription; HET: ALY MES; 2.00A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1s7g_A* 1yc2_A* Back     alignment and structure
>1q14_A HST2 protein; histone deacetylase, hydrolase; 2.50A {Saccharomyces cerevisiae} SCOP: c.31.1.5 Back     alignment and structure
>1m2k_A Silent information regulator 2; protein-ligand complex, gene regulation; HET: APR; 1.47A {Archaeoglobus fulgidus} SCOP: c.31.1.5 PDB: 1m2g_A* 1m2h_A* 1m2j_A* 1m2n_A* 1ici_A* Back     alignment and structure
>3k35_A NAD-dependent deacetylase sirtuin-6; rossmann fold, Zn-binding domain, structural genomics, struc genomics consortium, SGC, ADP-ribosylation; HET: APR; 2.00A {Homo sapiens} Back     alignment and structure
>1j8f_A SIRT2, sirtuin 2, isoform 1, silencing INFO; gene regulation, transferase; 1.70A {Homo sapiens} SCOP: c.31.1.5 Back     alignment and structure
>3riy_A NAD-dependent deacetylase sirtuin-5; desuccinylase, demalonylase, posttranslational modification, binding domain, rossmann fold domain; HET: SLL NAD; 1.55A {Homo sapiens} SCOP: c.31.1.5 PDB: 3rig_A* 4f4u_A* 4f56_A* 4hda_A* 2b4y_A* 2nyr_A* 4g1c_A* Back     alignment and structure
>3glr_A NAD-dependent deacetylase sirtuin-3, mitochondria; NAD dependent deacetylase, sirtuin, substrate peptide comple hydrolase, metal-binding; HET: ALY; 1.80A {Homo sapiens} PDB: 3gls_A 3glt_A* 3glu_A 4hd8_A* 4fvt_A* Back     alignment and structure
>3pki_A NAD-dependent deacetylase sirtuin-6; ADP ribose, structural genomics, structural genomics consortium, SGC, hydrolase; HET: AR6; 2.04A {Homo sapiens} PDB: 3pkj_A* Back     alignment and structure
>4iao_A NAD-dependent histone deacetylase SIR2; protein complex, deacetylase, nucleus, hydrolase-trans complex; HET: APR; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3u31_A SIR2A, transcriptional regulatory protein SIR2 homologue; Zn-binding domain, rossmann fold domain; HET: MYK NAD; 2.20A {Plasmodium falciparum} PDB: 3u3d_A* 3jwp_A* Back     alignment and structure
>3lq1_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene- 1-carboxylate synthase; menaquinone biosynthesis, sephchc synthase, structural genomics; 2.60A {Listeria monocytogenes} Back     alignment and structure
>1ozh_A ALS, acetolactate synthase, catabolic; acetohydroxyacid synthase, thiamin diphosphate, lyase; HET: PGE HE3; 2.00A {Klebsiella pneumoniae} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1ozg_A* 1ozf_A* Back     alignment and structure
>1q6z_A BFD, BFDC, benzoylformate decarboxylase; lyase, carbon-carbon, mandelate catabolism, T thiazolone diphosphate, inhibitor, high resolution; HET: TZD; 1.00A {Pseudomonas putida} SCOP: c.31.1.3 c.36.1.5 c.36.1.9 PDB: 1po7_A* 1pi3_A* 3fsj_X* 1mcz_A* 1bfd_A* 2fwn_A* 3fzn_A* 2fn3_A* 2v3w_A* 1yno_A* 3f6b_X* 3f6e_X* Back     alignment and structure
>2x7j_A 2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene -1-carboxylate synthase; transferase, metal-binding; HET: TPP; 2.35A {Bacillus subtilis} Back     alignment and structure
>3eya_A Pyruvate dehydrogenase [cytochrome]; pyruvate oxidase, membrane-associated flavoprotein dehydrogenase, interactions with lipids cell membrane; HET: TDP FAD; 2.50A {Escherichia coli} PDB: 3ey9_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 108
d1efva2124 c.31.1.2 (A:208-331) C-terminal domain of the elec 3e-35
d3clsd2123 c.31.1.2 (D:196-318) C-terminal domain of the elec 9e-34
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: C-terminal domain of the electron transfer flavoprotein alpha subunit
domain: C-terminal domain of the electron transfer flavoprotein alpha subunit
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  114 bits (288), Expect = 3e-35
 Identities = 54/59 (91%), Positives = 57/59 (96%)

Query: 50  PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL 108
           PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQV+DYG+VADLFK VPE+TE L
Sbjct: 65  PELYIAVGISGAIQHLAGMKDSKTIVAINKDPEAPIFQVADYGIVADLFKVVPEMTEIL 123


>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Length = 123 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query108
d1efva2124 C-terminal domain of the electron transfer flavopr 100.0
d3clsd2123 C-terminal domain of the electron transfer flavopr 100.0
d1yc5a1245 NAD-dependent deacetylase NpdA {Thermotoga maritim 97.09
d1q6za1160 Benzoylformate decarboxylase {Pseudomonas putida [ 96.88
d1s5pa_235 NAD-dependent deacetylase CobB {Escherichia coli [ 96.85
d1ma3a_252 AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeog 96.78
d2b4ya1267 NAD-dependent deacetylase sirtuin-5 {Human (Homo s 96.69
d1m2ka_249 AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeo 96.47
d1q1aa_289 Hst2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 96.12
d2ji7a1175 Oxalyl-CoA decarboxylase {Oxalobacter formigenes [ 95.84
d2ez9a1183 Pyruvate oxidase {Lactobacillus plantarum [TaxId: 95.57
d1ozha1179 Catabolic acetolactate synthase {Klebsiella pneumo 95.48
d1j8fa_323 Sirt2 histone deacetylase {Human (Homo sapiens) [T 95.05
d1t9ba1171 Acetohydroxyacid synthase catalytic subunit {Baker 94.83
d2djia1177 Pyruvate oxidase {Aerococcus viridans [TaxId: 1377 94.4
d1ybha1179 Acetohydroxyacid synthase catalytic subunit {Thale 94.06
d2ihta1177 Carboxyethylarginine synthase {Streptomyces clavul 93.24
>d1efva2 c.31.1.2 (A:208-331) C-terminal domain of the electron transfer flavoprotein alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: DHS-like NAD/FAD-binding domain
superfamily: DHS-like NAD/FAD-binding domain
family: C-terminal domain of the electron transfer flavoprotein alpha subunit
domain: C-terminal domain of the electron transfer flavoprotein alpha subunit
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=3.7e-46  Score=269.25  Aligned_cols=101  Identities=56%  Similarity=0.787  Sum_probs=94.1

Q ss_pred             eecCCccccccccccccccccchhhhhhc------------cccceeeeccCeeeCcceEEeeccchhhHhhhccCCCCe
Q psy15576          6 RNSNHKVLQITQTYNSFSQPHYPKLLTVQ------------IAETYISALKASQLIPELYIAVGISGAIQHLAGMKDSKT   73 (108)
Q Consensus         6 ~~s~~r~~~~~~~~~~~~~pva~kL~a~~------------i~~~~igg~SGktV~P~lYia~GISGA~QH~~Gm~~s~~   73 (108)
                      =+|+|||+++.||| ++.+-+|++||+.-            ..++++| +||++|+|+||||||||||+||++||++|++
T Consensus        11 vV~~GrG~~~~e~~-~~~~~lA~~lga~vg~SR~~vd~gw~~~~~qIG-~SG~~V~P~lyia~GISGa~QH~~Gi~~s~~   88 (124)
T d1efva2          11 VVSGGRGLKSGENF-KLLYDLADQLHAAVGASRAAVDAGFVPNDMQVG-QTGKIVAPELYIAVGISGAIQHLAGMKDSKT   88 (124)
T ss_dssp             EEEECGGGCSTGGG-HHHHHHHHHHTCEEEECHHHHHTTSSCGGGBBS-TTSBCCCCSEEEEESCCCCHHHHTTTTTCSE
T ss_pred             EEECCCCcCCHHHH-HHHHHHHHHhCCeeeEeehhhhCCCcccceeec-ccceEeCCcEEEEecchhHHHHHhhccCCCE
Confidence            37999999999999 66699999999872            5666666 9999999999999999999999999999999


Q ss_pred             EEEecCCCCCCcccccCeeEeeeHHHHHHHHHhhC
Q psy15576         74 IVAINKDPEAPIFQVSDYGLVADLFKAVPELTEKL  108 (108)
Q Consensus        74 IIAIN~Dp~ApIf~~ADygiVgD~~evlp~Li~~l  108 (108)
                      |||||+||+||||++|||+||+|++||||+|+++|
T Consensus        89 IvAIN~D~~ApIf~~aD~giVgD~~evlp~L~e~l  123 (124)
T d1efva2          89 IVAINKDPEAPIFQVADYGIVADLFKVVPEMTEIL  123 (124)
T ss_dssp             EEEEESCTTCGGGGTCSEEEESCHHHHHHHHHHHT
T ss_pred             EEEEeCCCCCCccccCCEEEeccHHHHHHHHHHHh
Confidence            99999999999999999999999999999999976



>d3clsd2 c.31.1.2 (D:196-318) C-terminal domain of the electron transfer flavoprotein alpha subunit {Methylophilus methylotrophus [TaxId: 17]} Back     information, alignment and structure
>d1yc5a1 c.31.1.5 (A:1-245) NAD-dependent deacetylase NpdA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1q6za1 c.31.1.3 (A:182-341) Benzoylformate decarboxylase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1s5pa_ c.31.1.5 (A:) NAD-dependent deacetylase CobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ma3a_ c.31.1.5 (A:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b4ya1 c.31.1.5 (A:36-302) NAD-dependent deacetylase sirtuin-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m2ka_ c.31.1.5 (A:) AF1676, Sir2 homolog (Sir2-AF1?) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q1aa_ c.31.1.5 (A:) Hst2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ji7a1 c.31.1.3 (A:195-369) Oxalyl-CoA decarboxylase {Oxalobacter formigenes [TaxId: 847]} Back     information, alignment and structure
>d2ez9a1 c.31.1.3 (A:183-365) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d1ozha1 c.31.1.3 (A:188-366) Catabolic acetolactate synthase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1j8fa_ c.31.1.5 (A:) Sirt2 histone deacetylase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t9ba1 c.31.1.3 (A:290-460) Acetohydroxyacid synthase catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2djia1 c.31.1.3 (A:187-363) Pyruvate oxidase {Aerococcus viridans [TaxId: 1377]} Back     information, alignment and structure
>d1ybha1 c.31.1.3 (A:281-459) Acetohydroxyacid synthase catalytic subunit {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure
>d2ihta1 c.31.1.3 (A:198-374) Carboxyethylarginine synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure