Diaphorina citri psyllid: psy15602


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--
MEVDRVVCAAATALRNLAIDQRNKELIDAFEANLILIELNLSPPAGKYAMRDLVQKLPSGNAQHDQGTSDDT
ccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccHHHHHHHHcccccccccccccccc
***DRVVCAAATALRNLAIDQRNKELIDAFEANLILIELNLSPPAGKYAMRD********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVDRVVCAAATALRNLAIDQRNKELIDAFEANLILIELNLSPPAGKYAMRDLVQKLPSGNAQHDQGTSDDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Catenin delta-2 Functions as a transcriptional activator when bound to ZBTB33 (By similarity). May be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules.confidentQ9UQB3
Plakophilin-4 Plays a role as a regulator of Rho activity during cytokinesis. May play a role in junctional plaques.confidentQ68FH0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030057 [CC]desmosomeprobableGO:0005575, GO:0070161, GO:0030054, GO:0005911
GO:0000922 [CC]spindle poleprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0044291 [CC]cell-cell contact zoneprobableGO:0005575, GO:0030054, GO:0005911
GO:0009898 [CC]internal side of plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051233 [CC]spindle midzoneprobableGO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0071777 []positive regulation of cell cycle cytokinesisprobable
GO:0030496 [CC]midbodyprobableGO:0005575, GO:0044464, GO:0005623
GO:0001763 [BP]morphogenesis of a branching structureprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0009653, GO:0044699
GO:0072686 [CC]mitotic spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0032321 [BP]positive regulation of Rho GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0035023, GO:0046578, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0043085, GO:0032319, GO:0032318, GO:0043547, GO:0051345, GO:0009966, GO:0031323, GO:0030811, GO:0065007, GO:0044093, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0032320, GO:0031329, GO:0006140

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3L6X, chain A
Confidence level:very confident
Coverage over the Query: 2-27,46-69
View the alignment between query and template
View the model in PyMOL