Diaphorina citri psyllid: psy15606


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MSTLDRLKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR
ccHHHHHHccccccEECcccccccccccccccccccccccHHHHcccccccccccccccccccCCccccccccccccccc
*********GLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQ*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTLDRLKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004623 [MF]phospholipase A2 activityprobableGO:0016787, GO:0016788, GO:0003824, GO:0003674, GO:0052689, GO:0004620, GO:0016298

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1POC, chain A
Confidence level:very confident
Coverage over the Query: 15-80
View the alignment between query and template
View the model in PyMOL