Psyllid ID: psy15606


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MSTLDRLKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR
ccHHHHHHccccccEEEcccccccccccccccccccccccHHHHcccccccccccccccccccEEccccccccccccccc
cccHHHHHHcccccEEcccccccccccccccHHHccccccHHHHHHHcccccccccccccccccccccccEccccccccc
MSTLDRLKLglsnlmlvpgtkwcgygngatgftdlgsfsstdlccrrhdscqytipgfswrykyfnmkpftlshctcdqr
mstldrlkLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFtlshctcdqr
MSTLDRLKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR
******LKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTC***
***********SNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQ*
MSTLDRLKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR
**T**R***GLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCD**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTLDRLKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
P80003142 Acidic phospholipase A2 P N/A N/A 0.812 0.457 0.430 3e-13
P16354143 Phospholipase A2 isozymes N/A N/A 0.812 0.454 0.430 5e-12
Q1JPB9 501 Group 3 secretory phospho yes N/A 0.8 0.127 0.468 5e-12
Q9NZ20 509 Group 3 secretory phospho yes N/A 0.8 0.125 0.453 1e-10
P0C8L9239 Phospholipase A2 OS=Hadru N/A N/A 0.775 0.259 0.444 4e-10
Q6PXP0157 Phospholipase A2 phaiodac N/A N/A 0.8 0.407 0.424 2e-08
P00630167 Phospholipase A2 OS=Apis no N/A 0.875 0.419 0.371 2e-08
Q7M4I6136 Phospholipase A2 OS=Megab N/A N/A 0.825 0.485 0.393 4e-08
P82971136 Phospholipase A2 OS=Bombu no N/A 0.825 0.485 0.409 4e-08
P59888167 Phospholipase A2 imperato N/A N/A 0.737 0.353 0.45 7e-08
>sp|P80003|PA2A2_HELSU Acidic phospholipase A2 PA4 OS=Heloderma suspectum PE=1 SV=2 Back     alignment and function desciption
 Score = 73.6 bits (179), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 42/65 (64%)

Query: 16 LVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHC 75
          ++PGT WCG GN A+ ++ LG+   TD+CCR HD C  T+    +++   N +P T+SHC
Sbjct: 4  IMPGTLWCGAGNAASDYSQLGTEKDTDMCCRDHDHCSDTMAALEYKHGMRNYRPHTVSHC 63

Query: 76 TCDQR 80
           CD +
Sbjct: 64 DCDNQ 68




PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides.
Heloderma suspectum (taxid: 8554)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 4
>sp|P16354|PA23_HELSU Phospholipase A2 isozymes PA3A/PA3B/PA5 OS=Heloderma suspectum PE=1 SV=3 Back     alignment and function description
>sp|Q1JPB9|PA2G3_BOVIN Group 3 secretory phospholipase A2 OS=Bos taurus GN=PLA2G3 PE=2 SV=1 Back     alignment and function description
>sp|Q9NZ20|PA2G3_HUMAN Group 3 secretory phospholipase A2 OS=Homo sapiens GN=PLA2G3 PE=1 SV=2 Back     alignment and function description
>sp|P0C8L9|PA2_HADGE Phospholipase A2 OS=Hadrurus gertschi PE=2 SV=1 Back     alignment and function description
>sp|Q6PXP0|PA2_ANUPH Phospholipase A2 phaiodactylipin OS=Anuroctonus phaiodactylus PE=1 SV=2 Back     alignment and function description
>sp|P00630|PA2_APIME Phospholipase A2 OS=Apis mellifera PE=1 SV=3 Back     alignment and function description
>sp|Q7M4I6|PA2_MEGPE Phospholipase A2 OS=Megabombus pennsylvanicus PE=1 SV=1 Back     alignment and function description
>sp|P82971|PA2_BOMTE Phospholipase A2 OS=Bombus terrestris PE=1 SV=1 Back     alignment and function description
>sp|P59888|IPTXI_PANIM Phospholipase A2 imperatoxin-1 OS=Pandinus imperator PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
82658234 528 group 3 secretory phospholipase A2 precu 0.812 0.123 0.615 9e-18
157119864 285 hypothetical protein AaeL_AAEL001528 [Ae 0.987 0.277 0.468 1e-16
156553155 338 PREDICTED: hypothetical protein LOC10011 0.975 0.230 0.525 1e-16
242007584 360 phospholipase A2, putative [Pediculus hu 0.95 0.211 0.467 2e-16
195165240 206 GL20365 [Drosophila persimilis] gi|19410 1.0 0.388 0.506 3e-16
125981539 206 GA13978 [Drosophila pseudoobscura pseudo 1.0 0.388 0.506 3e-16
158288054137 AGAP011569-PA [Anopheles gambiae str. PE 0.912 0.532 0.493 3e-15
405976549 270 Phospholipase A2 isozymes PA3A/PA3B/PA5 0.887 0.262 0.521 4e-15
21483442 240 LD41157p [Drosophila melanogaster] 0.937 0.312 0.513 4e-15
195355831 218 GM11233 [Drosophila sechellia] gi|194130 0.937 0.344 0.513 4e-15
>gi|82658234|ref|NP_001032489.1| group 3 secretory phospholipase A2 precursor [Danio rerio] gi|79151926|gb|AAI08012.1| Zgc:123275 [Danio rerio] Back     alignment and taxonomy information
 Score = 94.0 bits (232), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 40/65 (61%), Positives = 47/65 (72%)

Query: 16  LVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHC 75
           ++PGT WCG GN ATG+TDLG F  TD CCR HD C++TIP FS+ +  FN   FTLSHC
Sbjct: 159 MIPGTLWCGSGNKATGWTDLGVFEETDKCCREHDHCKHTIPSFSYDHGVFNTNLFTLSHC 218

Query: 76  TCDQR 80
            CD R
Sbjct: 219 DCDNR 223




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|157119864|ref|XP_001659544.1| hypothetical protein AaeL_AAEL001528 [Aedes aegypti] gi|108883128|gb|EAT47353.1| AAEL001528-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|156553155|ref|XP_001602018.1| PREDICTED: hypothetical protein LOC100117899 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242007584|ref|XP_002424617.1| phospholipase A2, putative [Pediculus humanus corporis] gi|212508068|gb|EEB11879.1| phospholipase A2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195165240|ref|XP_002023447.1| GL20365 [Drosophila persimilis] gi|194105552|gb|EDW27595.1| GL20365 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|125981539|ref|XP_001354773.1| GA13978 [Drosophila pseudoobscura pseudoobscura] gi|54643084|gb|EAL31828.1| GA13978 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|158288054|ref|XP_309938.3| AGAP011569-PA [Anopheles gambiae str. PEST] gi|157019289|gb|EAA05678.3| AGAP011569-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|405976549|gb|EKC41051.1| Phospholipase A2 isozymes PA3A/PA3B/PA5 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|21483442|gb|AAM52696.1| LD41157p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195355831|ref|XP_002044391.1| GM11233 [Drosophila sechellia] gi|194130709|gb|EDW52752.1| GM11233 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
ZFIN|ZDB-GENE-051113-96 528 zgc:123275 "zgc:123275" [Danio 0.95 0.143 0.55 1e-19
FB|FBgn0030013272 GIIIspla2 [Drosophila melanoga 0.875 0.257 0.535 4.6e-18
UNIPROTKB|Q1JPB9 501 PLA2G3 "Group 3 secretory phos 0.8 0.127 0.468 2.9e-13
UNIPROTKB|F1RPC3 501 PLA2G3 "Uncharacterized protei 0.8 0.127 0.468 2.9e-13
UNIPROTKB|E1BEM2 516 E1BEM2 "Uncharacterized protei 0.8 0.124 0.468 3.1e-13
FB|FBgn0250862363 CG42237 [Drosophila melanogast 0.787 0.173 0.460 1.3e-12
UNIPROTKB|Q9NZ20 509 PLA2G3 "Group 3 secretory phos 0.8 0.125 0.453 5.9e-12
UNIPROTKB|F1Q3B4 512 PLA2G3 "Uncharacterized protei 0.8 0.125 0.453 6e-12
FB|FBgn0029720 364 CG3009 [Drosophila melanogaste 0.812 0.178 0.461 1.3e-11
UNIPROTKB|E2RAU3 509 PLA2G3 "Uncharacterized protei 0.8 0.125 0.453 2.6e-11
ZFIN|ZDB-GENE-051113-96 zgc:123275 "zgc:123275" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 242 (90.2 bits), Expect = 1.0e-19, P = 1.0e-19
 Identities = 44/80 (55%), Positives = 52/80 (65%)

Query:     1 MSTLDRLKLGLSNLMLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSW 60
             + TL R K       ++PGT WCG GN ATG+TDLG F  TD CCR HD C++TIP FS+
Sbjct:   148 IKTLQRSK----RAWMIPGTLWCGSGNKATGWTDLGVFEETDKCCREHDHCKHTIPSFSY 203

Query:    61 RYKYFNMKPFTLSHCTCDQR 80
              +  FN   FTLSHC CD R
Sbjct:   204 DHGVFNTNLFTLSHCDCDNR 223




GO:0004623 "phospholipase A2 activity" evidence=IEA
GO:0006644 "phospholipid metabolic process" evidence=IEA
GO:0016042 "lipid catabolic process" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005576 "extracellular region" evidence=IEA
FB|FBgn0030013 GIIIspla2 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JPB9 PLA2G3 "Group 3 secretory phospholipase A2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPC3 PLA2G3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BEM2 E1BEM2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0250862 CG42237 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZ20 PLA2G3 "Group 3 secretory phospholipase A2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3B4 PLA2G3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
FB|FBgn0029720 CG3009 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAU3 PLA2G3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.10.691
3rd Layer3.1.1.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
cd0470497 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: 1e-26
pfam0582699 pfam05826, Phospholip_A2_2, Phospholipase A2 4e-22
cd04705100 cd04705, PLA2_group_III_like, PLA2_group_III_like: 1e-05
cd0061883 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a 7e-05
>gnl|CDD|153093 cd04704, PLA2_bee_venom_like, PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information
 Score = 92.7 bits (231), Expect = 1e-26
 Identities = 35/64 (54%), Positives = 41/64 (64%)

Query: 17 VPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCT 76
          VPGTKWCG GN AT ++DLG+F  TD CCR HD C   I    ++Y   N + FT SHC 
Sbjct: 3  VPGTKWCGPGNIATNYSDLGAFRETDKCCREHDHCPDIISAGEYKYGLTNTRLFTRSHCD 62

Query: 77 CDQR 80
          CD R
Sbjct: 63 CDNR 66


PLA2 is a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent. Enzymatically active PLA2 cleaves the sn-2 position of the glycerol backbone of phospholipids; secreted PLA2s have also been found to specifically bind to a variety of soluble and membrane proteins in mammals, including receptors. As a toxin, PLA2 is a potent presynaptic neurotoxin which blocks nerve terminals by binding to the nerve membrane and hydrolyzing stable membrane lipids. The products of the hydrolysis cannot form bilayers leading to a change in membrane conformation and ultimately to a block in the release of neurotransmitters. PLA2 may form dimers or oligomers. Bee venom PLA2 has fewer conserved disulfide bridges than most canonical PLA2s. Length = 97

>gnl|CDD|147789 pfam05826, Phospholip_A2_2, Phospholipase A2 Back     alignment and domain information
>gnl|CDD|153094 cd04705, PLA2_group_III_like, PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 Back     alignment and domain information
>gnl|CDD|153092 cd00618, PLA2_like, PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
PF0582699 Phospholip_A2_2: Phospholipase A2; InterPro: IPR00 100.0
cd0470497 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-fam 100.0
cd04705100 PLA2_group_III_like PLA2_group_III_like: A sub-fam 99.87
cd0061883 PLA2_like PLA2_like: Phospholipase A2, a super-fam 99.72
smart00085117 PA2c Phospholipase A2. 99.22
cd04706117 PLA2_plant PLA2_plant: Plant-specific sub-family o 98.33
PF0839864 Parvo_coat_N: Parvovirus coat protein VP1; InterPr 96.7
cd00125115 PLA2c PLA2c: Phospholipase A2, a family of secreto 96.6
cd04707117 otoconin_90 otoconin_90: Phospholipase A2-like dom 96.03
KOG4087|consensus144 94.76
PF00068116 Phospholip_A2_1: Phospholipase A2; InterPro: IPR00 91.65
>PF05826 Phospholip_A2_2: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 Back     alignment and domain information
Probab=100.00  E-value=4.3e-40  Score=215.79  Aligned_cols=65  Identities=54%  Similarity=1.110  Sum_probs=49.8

Q ss_pred             eecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCCC
Q psy15606         16 LVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR   80 (80)
Q Consensus        16 ~~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~r   80 (80)
                      |||||||||+||+|.+|+|||.+.+||+|||+||+|+++|+++++||||+|.++||+|||+||+|
T Consensus         1 i~pGT~WCG~gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~~hC~Cd~~   65 (99)
T PF05826_consen    1 IYPGTKWCGPGNIAKNYSDLGEFKETDRCCREHDHCPDKIPPGETKYGLHNPRPFTISHCDCDSR   65 (99)
T ss_dssp             B-TT-SSSBSS---SSTT---SSHHHHHHHHHHHT-SSEE-TT-EETTEE--SSS-EEBHHHHHH
T ss_pred             CCCCCcccCCCCCccCcccccccHHHHHHHHhhccCCCccCCCccccccccCCcCceeecCcccH
Confidence            79999999999999999999999999999999999999999999999999999999999999964



1.1.4 from EC) (PLA2) is a small lipolytic enzyme that releases fatty acids from the second carbon group of glycerol. It is involved in a number of physiologically important cellular processes, such as the liberation of arachidonic acid from membrane phospholipids []. It plays a pivotal role in the biosynthesis of prostaglandin and other mediators of inflammation. PLA2 has four to seven disulphide bonds and binds a calcium ion that is essential for activity. Within the active enzyme, the alpha amino group is involved in a conserved hydrogen-bonding network linking the N-terminal region to the active site. The side chains of two conserved residues, His and Asp, participate in the catalytic network. Many PLA2's are widely distributed in snakes, lizards, bees and mammals. In mammals there are at least four forms: pancreatic, membrane-associated as well as two less well characterised forms. The venom of most snakes contains multiple forms of PLA2. Some of them are presynaptic neurotoxins which inhibit neuromuscular transmission by blocking acetylcholine release from the nerve termini. Some of the proteins in this family are allergens. Allergies are hypersensitivity reactions of the immune system to specific substances called allergens (such as pollen, stings, drugs, or food) that, in most people, result in no symptoms. A nomenclature system has been established for antigens (allergens) that cause IgE-mediated atopic allergies in humans [WHO/IUIS Allergen Nomenclature Subcommittee King T.P., Hoffmann D., Loewenstein H., Marsh D.G., Platts-Mills T.A.E., Thomas W. Bull. World Health Organ. 72:797-806(1994)]. This nomenclature system is defined by a designation that is composed of the first three letters of the genus; a space; the first letter of the species name; a space and an arabic number. In the event that two species names have identical designations, they are discriminated from one another by adding one or more letters (as necessary) to each species designation. The allergens in this family include allergens with the following designations: Api m 1.; GO: 0004623 phospholipase A2 activity, 0005509 calcium ion binding, 0016042 lipid catabolic process; PDB: 1POC_A.

>cd04704 PLA2_bee_venom_like PLA2_bee_venom_like: A sub-family of Phospholipase A2, similar to bee venom PLA2 Back     alignment and domain information
>cd04705 PLA2_group_III_like PLA2_group_III_like: A sub-family of Phospholipase A2, similar to human group III PLA2 Back     alignment and domain information
>cd00618 PLA2_like PLA2_like: Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>smart00085 PA2c Phospholipase A2 Back     alignment and domain information
>cd04706 PLA2_plant PLA2_plant: Plant-specific sub-family of Phospholipase A2, a super-family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>PF08398 Parvo_coat_N: Parvovirus coat protein VP1; InterPro: IPR013607 Parvoviruses are some of the smallest viruses containing linear, non-segmented single-stranded DNA genomes, with an average genome size of 5000 nucleotides Back     alignment and domain information
>cd00125 PLA2c PLA2c: Phospholipase A2, a family of secretory and cytosolic enzymes; the latter are either Ca dependent or Ca independent Back     alignment and domain information
>cd04707 otoconin_90 otoconin_90: Phospholipase A2-like domains present in otoconin-90 and otoconin-95, mammal proteins that are principal matrix proteins of calcitic otoconia Back     alignment and domain information
>KOG4087|consensus Back     alignment and domain information
>PF00068 Phospholip_A2_1: Phospholipase A2; InterPro: IPR001211 Phospholipase A2 (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
1poc_A134 Crystal Structure Of Bee-venom Phospholipase A2 In 6e-09
>pdb|1POC|A Chain A, Crystal Structure Of Bee-venom Phospholipase A2 In A Complex With A Transition-state Analogue Length = 134 Back     alignment and structure

Iteration: 1

Score = 55.8 bits (133), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 25/66 (37%), Positives = 35/66 (53%) Query: 15 MLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSH 74 ++ PGT WCG+GN ++G +LG F TD CCR HD C + ++ N T Sbjct: 1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLS 60 Query: 75 CTCDQR 80 C CD + Sbjct: 61 CDCDDK 66

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 3e-23
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Length = 134 Back     alignment and structure
 Score = 84.7 bits (209), Expect = 3e-23
 Identities = 25/66 (37%), Positives = 35/66 (53%)

Query: 15 MLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSH 74
          ++ PGT WCG+GN ++G  +LG F  TD CCR HD C   +     ++   N    T   
Sbjct: 1  IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLS 60

Query: 75 CTCDQR 80
          C CD +
Sbjct: 61 CDCDDK 66


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
1poc_A134 Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis 100.0
2wg7_A130 PLA2, putative phospholipase A2; hydrolase, secret 96.72
1gp7_A151 Phospholipase A2; snake venom, KING cobra, cardiot 94.62
1g4i_A123 Phospholipase A2; lipid degradation, hydrolase; 0. 94.48
3jql_A119 Phospholipase A2 isoform 3; phospholipase A2, hexa 94.41
1p7o_A124 Phospholipase A2, mipla4; pancreatic loop, HYDR; 2 94.38
1jlt_A122 Phospholipase A2 inhibitor; heterodimer complex, h 94.32
2g58_A121 Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, d 94.32
3u8i_A124 Phospholipase A2, membrane associated; secreted ph 94.27
1zlb_A122 Hypotensive phospholipase A2; Asp49-PLA2, toxin, s 94.17
2aoz_A121 Myotoxin II, phospholipase A2 homolog; X-RAY diffr 94.14
4e4c_A119 Phospholipase A2; hydrolase; HET: MES; 1.80A {Note 94.13
1bk9_A124 Phospholipase A2; hydrolase, platelet aggregation 94.09
4h0q_A121 Phospholipase A2, acid 5; alpha-helix, glycerophos 94.05
3vbz_A118 Phospholipase A2 homolog, taipoxin beta chain; pho 94.05
1bun_A120 BETA2-bungarotoxin; hydrolase, presynaptic neuroto 94.05
2qhd_A122 Phospholipase A2; beta sheet, three helices, prote 94.04
3r0l_D122 Phospholipase A2 CB; crotoxin, presynaptic neuroto 94.04
3dih_A122 Phospholipase A2 homolog, ammodytin L; phospholipa 93.83
2h4c_B122 Phospholipase A2-II; non-inhibitor acidic PLA2, ba 93.82
1g0z_A118 Phospholipase A2; toxin; 2.18A {Bungarus caeruleus 93.81
1gmz_A122 Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bot 93.76
1jlt_B122 Phospholipase A2, vipoxin; heterodimer complex, hy 93.75
4hg9_A122 Basic phospholipase A2 B; alpha-helix, glycerophos 93.61
1m8t_A119 Phospholipase A2; twinned crystal, alpha, beta, hy 93.55
4h0s_A137 Svpla2 homolog, basic phospholipase A2 homolog CTS 93.53
1mc2_A122 Acutohaemonlysin, phospholipase A2; YS49-phospholi 93.51
1oz6_A120 Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A { 93.4
1vip_A121 Phospholipase A2; hydrolase, anticoagulant; 2.20A 93.23
1le6_A123 Group X secretory phospholipase A2; human phosphat 93.11
3ntt_A 724 Capsid protein; gene therapy vector, cystic fibros 90.83
3ng9_A 736 Capsid protein; beta barrel, single-stranded DNA V 82.49
>1poc_A Phospholipase A2; hydrolase; HET: GEL; 2.00A {Apis mellifera} SCOP: a.133.1.1 Back     alignment and structure
Probab=100.00  E-value=1.7e-38  Score=217.14  Aligned_cols=66  Identities=38%  Similarity=0.808  Sum_probs=64.4

Q ss_pred             eeecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCCC
Q psy15606         15 MLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR   80 (80)
Q Consensus        15 ~~~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~r   80 (80)
                      ||+|||||||+||+|.+|+|||.+.+||+|||+||+|+++|++++++|||+|.++||+|||+||++
T Consensus         1 ~i~pGTkWCG~Gn~a~~~~dlG~~~~tD~CCR~HD~C~~~I~~~~~~~gl~N~~~~t~shC~CD~~   66 (134)
T 1poc_A            1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDK   66 (134)
T ss_dssp             CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSSSCEEBHHHHHH
T ss_pred             CcCCCCcccCCCCCCCCcccccCcchHhHHHhccccCcccccCccccCCeeCCCccccccCcHHHH
Confidence            699999999999999999999999999999999999999999999999999999999999999964



>2wg7_A PLA2, putative phospholipase A2; hydrolase, secretory PLA2; 2.00A {Oryza sativa} PDB: 2wg9_A* 2wg8_B 2wg8_A Back     alignment and structure
>1gp7_A Phospholipase A2; snake venom, KING cobra, cardiotoxic activity, myotoxic activity, pancreatic loop, hydrolase, lipid degradation, calcium; 2.6A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>1g4i_A Phospholipase A2; lipid degradation, hydrolase; 0.97A {Bos taurus} SCOP: a.133.1.2 PDB: 1bvm_A 1fdk_A* 1bp2_A 1mkt_A 1mkv_A* 1une_A 2bpp_A 4bp2_A 2bp2_A 1kvy_A 1bpq_A 2zp3_A 1ceh_A 3bp2_A 2zp5_A 1kvx_A 1kvw_A 2zp4_A 1irb_A 2bax_A* ... Back     alignment and structure
>3jql_A Phospholipase A2 isoform 3; phospholipase A2, hexapeptide, hydrolase, calcium, disulfide bond, lipid degradation, metal-binding, secreted; 1.20A {Naja sagittifera} SCOP: a.133.1.2 PDB: 1mf4_A 3jq5_A 1ln8_A 3jti_A 3nju_A* 3osh_A* 3q4y_A 1t37_A 1zm6_A 3gci_A 1yxl_A 1oxr_A 1td7_A* 1sz8_A 1a3d_A 1a3f_A 1psh_A 2osh_A 1poa_A 1pob_A* ... Back     alignment and structure
>1p7o_A Phospholipase A2, mipla4; pancreatic loop, HYDR; 2.30A {Micropechis ikaheka} SCOP: a.133.1.2 PDB: 1pwo_A 1ozy_A Back     alignment and structure
>1jlt_A Phospholipase A2 inhibitor; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1vpi_A 1aok_A 1q5t_A 1oqs_A 2h4c_A Back     alignment and structure
>2g58_A Phospholipase A2 VRV-PL-VIIIA; phospholipase A2, diars, hydrolase-hydrolase inhibitor compl; HET: PHQ; 0.98A {Daboia russellii pulchella} SCOP: a.133.1.2 PDB: 1cl5_A 1fb2_A* 1jq8_A 1jq9_A 1kpm_A* 1oxl_A* 1fv0_A* 1q7a_A 1skg_A* 1sv3_A* 1sv9_A* 1sxk_A* 1tdv_A 1tg1_A* 1tg4_A 1th6_A* 1sqz_A 1tjq_A* 1tk4_A 1tp2_A* ... Back     alignment and structure
>3u8i_A Phospholipase A2, membrane associated; secreted phospholipase A2, hydrolase; HET: OLD; 1.10A {Homo sapiens} PDB: 3u8d_A* 1ayp_A 1db4_A* 1db5_A* 1dcy_A* 1j1a_A* 1bbc_A* 1kqu_A* 1pod_A 1poe_A* 3u8b_A 1kvo_A* 3u8h_A* 1n28_B 1n29_A Back     alignment and structure
>1zlb_A Hypotensive phospholipase A2; Asp49-PLA2, toxin, snake venom, hydrolase; 0.97A {Bothrops jararacussu} SCOP: a.133.1.2 PDB: 1umv_X 1zl7_A 1z76_A* 1u73_A* 1vap_A 3r0l_A Back     alignment and structure
>2aoz_A Myotoxin II, phospholipase A2 homolog; X-RAY diffration, myotoxicity, atropoides toxin; 2.08A {Atropoides nummifer} Back     alignment and structure
>4e4c_A Phospholipase A2; hydrolase; HET: MES; 1.80A {Notechis scutatus scutatus} PDB: 1ae7_A* 2not_A Back     alignment and structure
>1bk9_A Phospholipase A2; hydrolase, platelet aggregation inhibitor, PBPB; HET: PBP; 2.00A {Gloydius halys} SCOP: a.133.1.2 PDB: 1psj_A 1ijl_A 1pp2_R Back     alignment and structure
>4h0q_A Phospholipase A2, acid 5; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.60A {Viridovipera stejnegeri} PDB: 1m8r_A 1m8s_A Back     alignment and structure
>3vbz_A Phospholipase A2 homolog, taipoxin beta chain; phospholipase A2 fold, PLA2 fold, neurotoxin, binding; 1.76A {Oxyuranus scutellatus scutellatus} PDB: 3vc0_A Back     alignment and structure
>1bun_A BETA2-bungarotoxin; hydrolase, presynaptic neurotoxin; 2.45A {Bungarus multicinctus} SCOP: a.133.1.2 Back     alignment and structure
>2qhd_A Phospholipase A2; beta sheet, three helices, protein-ligand complex, hydrolase; HET: DAO; 1.95A {Echis carinatus} PDB: 2qhe_A 3bjw_A* Back     alignment and structure
>3r0l_D Phospholipase A2 CB; crotoxin, presynaptic neurotoxin, snake venom, phospholipase heterodimer interface, hydrolase; 1.35A {Crotalus durissus terrificus} SCOP: a.133.1.2 PDB: 2qog_B 2qog_A 1bjj_A 1a2a_A Back     alignment and structure
>3dih_A Phospholipase A2 homolog, ammodytin L; phospholipase A2 fold, myotoxin, secreted, toxin; 2.60A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 3ux7_A Back     alignment and structure
>2h4c_B Phospholipase A2-II; non-inhibitor acidic PLA2, basic PLA2, heterodimer, hydrolase; 2.60A {Daboia russellii siamensis} Back     alignment and structure
>1g0z_A Phospholipase A2; toxin; 2.18A {Bungarus caeruleus} SCOP: a.133.1.2 PDB: 1u4j_A* 1g2x_A 2osn_A 1dpy_A 1fe5_A 1tc8_A* 1po8_A* Back     alignment and structure
>1gmz_A Phospholipase A2; hydrolase, neurotoxic; 2.4A {Bothrops pirajai} SCOP: a.133.1.2 Back     alignment and structure
>1jlt_B Phospholipase A2, vipoxin; heterodimer complex, hydrolase, PLA2-activity; 1.40A {Vipera ammodytes ammodytes} SCOP: a.133.1.2 PDB: 1rgb_A* 2i0u_E* 1aok_B 1oqs_B Back     alignment and structure
>4hg9_A Basic phospholipase A2 B; alpha-helix, glycerophospholipid, venom gland, hydrolase; HET: CIT G3P; 1.60A {Gloydius halys} PDB: 1jia_A 1b4w_A 1c1j_A* Back     alignment and structure
>1m8t_A Phospholipase A2; twinned crystal, alpha, beta, hydrolase; 2.10A {Ophiophagus hannah} SCOP: a.133.1.2 Back     alignment and structure
>4h0s_A Svpla2 homolog, basic phospholipase A2 homolog CTS-R6; alpha-helix, glycerophospholipid, venom gland, hydrolase; 1.55A {Viridovipera stejnegeri} Back     alignment and structure
>1mc2_A Acutohaemonlysin, phospholipase A2; YS49-phospholipase A2, snake venom, toxin; 0.85A {Deinagkistrodon acutus} SCOP: a.133.1.2 PDB: 1mg6_A 1pa0_A 3i03_A* 3hzd_A 3hzw_A* 3cxi_A* 3i3h_A 3i3i_A 1pc9_A 2q2j_A 3cyl_A* 1qll_A* 1xxs_A* 3qnl_A* 2ok9_A* 3iq3_A* 2h8i_A* 3mlm_A* 1y4l_A* 1clp_A* ... Back     alignment and structure
>1oz6_A Phospholipase A2; enzyme, PLA2, hydrolase; 2.60A {Echis carinatus} SCOP: a.133.1.2 Back     alignment and structure
>1vip_A Phospholipase A2; hydrolase, anticoagulant; 2.20A {Daboia russellii russellii} SCOP: a.133.1.2 Back     alignment and structure
>1le6_A Group X secretory phospholipase A2; human phosphatidylcholine 2-acylhydrolase GX, GX SPLA2, SPLA2-X; 1.97A {Homo sapiens} SCOP: a.133.1.2 PDB: 1le7_A Back     alignment and structure
>3ntt_A Capsid protein; gene therapy vector, cystic fibros sialic acid receptor, icosahedral virus; 3.45A {Adeno-associated virus - 5} Back     alignment and structure
>3ng9_A Capsid protein; beta barrel, single-stranded DNA V parvovirus, icosahedral virus; HET: ADE; 2.50A {Adeno-associated virus - 1} PDB: 3kic_A* 3kie_A* 3j1q_A 3oah_A* 1vu0_U 1vu1_o 3tsx_A 3shm_A 1lp3_A 3j1s_A 2qa0_A 3ra2_A 3ra4_A* 3ra8_A* 3ra9_A* 3raa_A* 3ux1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 80
d1poca_134 a.133.1.1 (A:) Phospholipase A2 {European honeybee 5e-25
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Length = 134 Back     information, alignment and structure

class: All alpha proteins
fold: Phospholipase A2, PLA2
superfamily: Phospholipase A2, PLA2
family: Insect phospholipase A2
domain: Phospholipase A2
species: European honeybee (Apis mellifera) [TaxId: 7460]
 Score = 88.4 bits (219), Expect = 5e-25
 Identities = 25/66 (37%), Positives = 35/66 (53%)

Query: 15 MLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSH 74
          ++ PGT WCG+GN ++G  +LG F  TD CCR HD C   +     ++   N    T   
Sbjct: 1  IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLS 60

Query: 75 CTCDQR 80
          C CD +
Sbjct: 61 CDCDDK 66


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d1poca_134 Phospholipase A2 {European honeybee (Apis mellifer 100.0
d1g0za_118 Snake phospholipase A2 {Indian krait (Bungarus cae 96.53
d1buna_120 Snake phospholipase A2 {Many-banded krait (Bungaru 96.52
d1m8ta_119 Snake phospholipase A2 {King cobra (Ophiophagus ha 96.44
d1sz8a_119 Snake phospholipase A2 {Andaman cobra (Naja sagitt 96.35
d2g58a1121 Snake phospholipase A2 {Snake (Daboia russellii pu 96.19
d1ppaa_121 Snake phospholipase A2 {Eastern cottonmouth snake 96.17
d1mc2a_122 Snake phospholipase A2 {Hundred-pace snake (Agkist 96.14
d1n28a_124 Phospholipase A2 {Human (Homo sapiens), synovial f 96.09
d1m8ra_124 Snake phospholipase A2 {Snake (Agkistrodon halys) 96.05
d1g4ia_123 Phospholipase A2 {Cow (Bos taurus), pancreas [TaxI 96.02
d1oz6a_120 Snake phospholipase A2 {Saw-scaled viper (Echis ca 96.01
d1le6a_123 Phospholipase A2 {Human (Homo sapiens), SPLA2 [Tax 95.98
d1jiaa_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 95.98
d1bjja_122 Snake phospholipase A2 {Snake (Agkistrodon halys) 95.94
d1gmza_122 Snake phospholipase A2 {Snake (Bothrops pirajai), 95.93
d1ae7a_119 Snake phospholipase A2 {Mainland tiger snake (Note 95.92
d1p7oa_124 Snake phospholipase A2 {Small-eye snake (Micropech 95.82
d1jltb_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 95.68
d1zlba1122 Snake phospholipase A2 {Jararacussu (Bothrops jara 95.63
d1jlta_122 Snake phospholipase A2 {Sand viper (Vipera ammodyt 95.62
d1vipa_121 Snake phospholipase A2 {Russell's viper (Vipera ru 95.27
>d1poca_ a.133.1.1 (A:) Phospholipase A2 {European honeybee (Apis mellifera) [TaxId: 7460]} Back     information, alignment and structure
class: All alpha proteins
fold: Phospholipase A2, PLA2
superfamily: Phospholipase A2, PLA2
family: Insect phospholipase A2
domain: Phospholipase A2
species: European honeybee (Apis mellifera) [TaxId: 7460]
Probab=100.00  E-value=3.6e-40  Score=224.07  Aligned_cols=66  Identities=38%  Similarity=0.808  Sum_probs=64.4

Q ss_pred             eeecCccccCCCCCCCCCCCCCCCCchhhhcccccCCCCcccCCCccCCeecCCCccccCCccCCC
Q psy15606         15 MLVPGTKWCGYGNGATGFTDLGSFSSTDLCCRRHDSCQYTIPGFSWRYKYFNMKPFTLSHCTCDQR   80 (80)
Q Consensus        15 ~~~pGTkWCG~Gn~A~~y~dLG~~~~tD~CCR~HD~C~~~I~~~~~k~gl~N~~~~T~shC~CD~r   80 (80)
                      +|||||||||+||+|.+|+|||.+.+||+|||+||+||++|++++++|||+|.++||+|||+||.|
T Consensus         1 ~i~PGTkWCG~Gn~A~~~~dlG~~~~~D~CCR~HD~Cp~~I~~~~~k~gl~N~~~~TishC~CD~~   66 (134)
T d1poca_           1 IIYPGTLWCGHGNKSSGPNELGRFKHTDACCRTHDMCPDVMSAGESKHGLTNTASHTRLSCDCDDK   66 (134)
T ss_dssp             CBCTTCSSSBSSCCCSSTTCCCSSHHHHHHHHHHHTCSSEECTTCEETTEECCSSSCEEBHHHHHH
T ss_pred             CccCCCeecCCCCCCCCcccccCccccchhhHhHccCcccccccccccceecCCccccCCCchHHH
Confidence            699999999999999999999999999999999999999999999999999999999999999964



>d1g0za_ a.133.1.2 (A:) Snake phospholipase A2 {Indian krait (Bungarus caeruleus), different isoforms [TaxId: 132961]} Back     information, alignment and structure
>d1buna_ a.133.1.2 (A:) Snake phospholipase A2 {Many-banded krait (Bungarus multicinctus), beta2-bungarotoxin [TaxId: 8616]} Back     information, alignment and structure
>d1m8ta_ a.133.1.2 (A:) Snake phospholipase A2 {King cobra (Ophiophagus hannah), an acidic isoform [TaxId: 8665]} Back     information, alignment and structure
>d1sz8a_ a.133.1.2 (A:) Snake phospholipase A2 {Andaman cobra (Naja sagittifera), acidic isoform 1 [TaxId: 195058]} Back     information, alignment and structure
>d2g58a1 a.133.1.2 (A:1-133) Snake phospholipase A2 {Snake (Daboia russellii pulchella), different isoforms [TaxId: 97228]} Back     information, alignment and structure
>d1ppaa_ a.133.1.2 (A:) Snake phospholipase A2 {Eastern cottonmouth snake (Agkistrodon piscivorus piscivorus) [TaxId: 8716]} Back     information, alignment and structure
>d1mc2a_ a.133.1.2 (A:) Snake phospholipase A2 {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1n28a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), synovial fluid [TaxId: 9606]} Back     information, alignment and structure
>d1m8ra_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1g4ia_ a.133.1.2 (A:) Phospholipase A2 {Cow (Bos taurus), pancreas [TaxId: 9913]} Back     information, alignment and structure
>d1oz6a_ a.133.1.2 (A:) Snake phospholipase A2 {Saw-scaled viper (Echis carinatus) [TaxId: 40353]} Back     information, alignment and structure
>d1le6a_ a.133.1.2 (A:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} Back     information, alignment and structure
>d1jiaa_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1bjja_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Agkistrodon halys) [TaxId: 8714]} Back     information, alignment and structure
>d1gmza_ a.133.1.2 (A:) Snake phospholipase A2 {Snake (Bothrops pirajai), piratoxin III [TaxId: 113192]} Back     information, alignment and structure
>d1ae7a_ a.133.1.2 (A:) Snake phospholipase A2 {Mainland tiger snake (Notechis scutatus scutatus), notexin [TaxId: 8663]} Back     information, alignment and structure
>d1p7oa_ a.133.1.2 (A:) Snake phospholipase A2 {Small-eye snake (Micropechis ikaheka), different isoforms [TaxId: 66188]} Back     information, alignment and structure
>d1jltb_ a.133.1.2 (B:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin catalytic subunit [TaxId: 8704]} Back     information, alignment and structure
>d1zlba1 a.133.1.2 (A:1-122) Snake phospholipase A2 {Jararacussu (Bothrops jararacussu) [TaxId: 8726]} Back     information, alignment and structure
>d1jlta_ a.133.1.2 (A:) Snake phospholipase A2 {Sand viper (Vipera ammodytes meridionalis), vipoxin inhibitor [TaxId: 8704]} Back     information, alignment and structure
>d1vipa_ a.133.1.2 (A:) Snake phospholipase A2 {Russell's viper (Vipera russelli) [TaxId: 8707]} Back     information, alignment and structure