Diaphorina citri psyllid: psy15615


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900----
SAQGVVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLKITTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPTTPAPLVCYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPSPPPTTPRPTTQPPPVCYPGSPDPRCPRPPPSPTPTTPAPLVCYPGSSDPRCPTRPPPPPPPPPTTPAPPVCYPGSNDPRCPRPTPTTPPPPQCYLGSPDPRCPRPLPSSPSPPVCYPGSPDPRCPRPPSPTPEYVCYPGSIDPRCPRPPPTTQETYVCYPGSIDPRCPRPQPPQPSPTPLCYPGSPDPRCPRPPSPSPTPTCYPGSPDPRCRPSVPPPTSQPFIPVGLTPFVCTCNVTTPRPIPPPLCYPGSTDPRCPREEIYPTQQIPSFCFPGSIDPRCPKPLRPSSTFQPETYLPPLPDSASEYSIKRDVGLNCHPGSNDPKCNEISIPPNNQKGGLLRTESSSLGKGEVHEALFQLNKELGLTDDKKEFAHFYRTPSPTTPAPPQCYPGSPDPRCPRPPPSPTTPAPPQCYPGSPDPRCPRPPLSPTTPAPPQCYPGSPDPWSQNTCLI
ccccEEEEEEEcccccEEEEEcccccccccccccccccccEEEEEECccccccccccccccccccccccccccHccccccHHEEEccccccccCEEEEEEccccccccEEEECcccccccccccccccccccccEEEEEccccccEEEEEECcccccccEEHHHHHccccccccccccccccccccEEEcccccccccccccccccEEEEEEcccccccccccHHHHcccccccccccccccEEEEEccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
***GVVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLK**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SAQGVVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLKITTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPTTPAPLVCYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPSPPPTTPRPTTQPPPVCYPGSPDPRCPRPPPSPTPTTPAPLVCYPGSSDPRCPTRPPPPPPPPPTTPAPPVCYPGSNDPRCPRPTPTTPPPPQCYLGSPDPRCPRPLPSSPSPPVCYPGSPDPRCPRPPSPTPEYVCYPGSIDPRCPRPPPTTQETYVCYPGSIDPRCPRPQPPQPSPTPLCYPGSPDPRCPRPPSPSPTPTCYPGSPDPRCRPSVPPPTSQPFIPVGLTPFVCTCNVTTPRPIPPPLCYPGSTDPRCPREEIYPTQQIPSFCFPGSIDPRCPKPLRPSSTFQPETYLPPLPDSASEYSIKRDVGLNCHPGSNDPKCNEISIPPNNQKGGLLRTESSSLGKGEVHEALFQLNKELGLTDDKKEFAHFYRTPSPTTPAPPQCYPGSPDPRCPRPPPSPTTPAPPQCYPGSPDPRCPRPPLSPTTPAPPQCYPGSPDPWSQNTCLI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal peptidase complex subunit 3 Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.confidentP61008
Signal peptidase complex subunit 3 Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.confidentP28687
Signal peptidase complex subunit 3 Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.confidentP61009

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3IOX, chain A
Confidence level:probable
Coverage over the Query: 304-399
View the alignment between query and template
View the model in PyMOL
Template: 3IOX, chain A
Confidence level:probable
Coverage over the Query: 304-399
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 428-533
View the alignment between query and template
View the model in PyMOL
Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 471-546
View the alignment between query and template
View the model in PyMOL
Template: 1M2V, chain B
Confidence level:probable
Coverage over the Query: 428-533
View the alignment between query and template
View the model in PyMOL
Template: 3GDB, chain A
Confidence level:probable
Coverage over the Query: 471-546
View the alignment between query and template
View the model in PyMOL
Template: 3NWA, chain A
Confidence level:probable
Coverage over the Query: 414-434
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID ?Alignment Graph ?Confidence Level ? View Alignment and Template ?
Query
3h0g, chain Aprobable Alignment | Template Structure