Psyllid ID: psy15615

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900----

SAQGVVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLKITTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPTTPAPLVCYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPSPPPTTPRPTTQPPPVCYPGSPDPRCPRPPPSPTPTTPAPLVCYPGSSDPRCPTRPPPPPPPPPTTPAPPVCYPGSNDPRCPRPTPTTPPPPQCYLGSPDPRCPRPLPSSPSPPVCYPGSPDPRCPRPPSPTPEYVCYPGSIDPRCPRPPPTTQETYVCYPGSIDPRCPRPQPPQPSPTPLCYPGSPDPRCPRPPSPSPTPTCYPGSPDPRCRPSVPPPTSQPFIPVGLTPFVCTCNVTTPRPIPPPLCYPGSTDPRCPREEIYPTQQIPSFCFPGSIDPRCPKPLRPSSTFQPETYLPPLPDSASEYSIKRDVGLNCHPGSNDPKCNEISIPPNNQKGGLLRTESSSLGKGEVHEALFQLNKELGLTDDKKEFAHFYRTPSPTTPAPPQCYPGSPDPRCPRPPPSPTTPAPPQCYPGSPDPRCPRPPLSPTTPAPPQCYPGSPDPWSQNTCLI

ccccEEEEEEEcccccEEEEEcccccccccccccccccccEEEEEEEcccccccccccccccccccccccccHHHcccccHHEEEccccccccEEEEEEEccccccccEEEEEcccccccccccccccccccccEEEEEccccccEEEEEEEcccccccEEHHHHHccccccccccccccccccccEEEcccccccccccccccccEEEEEEcccccccccccHHHHcccccccccccccccEEEEEccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

ccccEEccEEEcccHHcHcccHHccccccccccccccEEEEEEEEccccccEEEEEcccccccccEEEEccccccEEEEEEEccccccccccccEEEEEEccHHHHHcEEEcccccccccEEEEEEccccEEEEEEEEEEEccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccccccccEEEEccccccHHHHHcccEEEEEHHcEEEEEcccccEcEEEEcccEEEccccccEEEEcccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc

saqgvvapVLTVSVAQAVIALKardrpvaplvnqasEIHVHYFHQInfertcalhpkgqfptkanfllkptselqSHRVAQAVIALKardrpvapliwinnsspvRQNLLLCyksnlipittyiqynsspVRQNLLLCyksnlipittyiqynsspVRQNLLLCyksnlipittyiqynsspvrqnlllknvpdysasreendlGFITFDLQANLTKIFNWNVKQLFLYLTaeyitpsnvlnQVVLWDRIIlrgenadlkfknmntkyyfwddgkglkittprpttqpppicypgspdprcprpppsptptttpapicypgsndprcptrppppppppttprpttqpppicypgspdprcprpppsptptttpttpaplvcypgsndprcptrppppppppttprpttqpppicypgspdprcprpppsptptttpapicypgsndprcpspppttprpttqpppvcypgspdprcprpppsptpttpaplvcypgssdprcptrpppppppppttpappvcypgsndprcprptpttppppqcylgspdprcprplpsspsppvcypgspdprcprppsptpeyvcypgsidprcprpppttqetyvcypgsidprcprpqppqpsptplcypgspdprcprppspsptptcypgspdprcrpsvppptsqpfipvgltpfvctcnvttprpippplcypgstdprcpreeiyptqqipsfcfpgsidprcpkplrpsstfqpetylpplpdsaseysikrdvglnchpgsndpkcneisippnnqkggllrtessslgkgEVHEALFQLNkelgltddkkefahfyrtpspttpappqcypgspdprcprpppspttpappqcypgspdprcprpplspttpappqcypgspdpwsqntcli

saqgvvapvltVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLiwinnsspvRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGenadlkfknMNTKYYFWDDGKGLKITTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPTTPAPLVCYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPSPPPTTPRPTTQPPPVCYPGSPDPRCPRPPPSPTPTTPAPLVCYPGSSDPRCPTRPPPPPPPPPTTPAPPVCYPGSNDPRCPRPTPTTPPPPQCYLGSPDPRCPRPLPSSPSPPVCYPGSPDPRCPRPPSPTPEYVCYPGSIDPRCPRPPPTTQETYVCYPGSIDPRCPRPQPPQPSPTPLCYPGSPDPRCPRPPSPSPTPTCYPGSPDPRCRPSVPPPTSQPFIPVGLTPFVCTCNVTTPRPIPPPLCYPGSTDPRCPREEIYPTQQIPSFCFPGSIDPRCPKPLRPSSTFQPETYLPPLPDSASEYSIKRDVGLNCHPGSNDPKCNEISIPPNNQKGGLLRTESSSLGKGEVHEALFQLNKELGLTDDKKEFAHFyrtpspttpappQCYPGSPDPRCPRPPPSPTTPAPPQCYPGSPDPRCPRPPLSPTTPAPPQCYPGSPDPWSQNTCLI

SAQGVVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLKIttprpttqpppICypgspdprcprpppsptptttpapicypGSNDprcptrppppppppttprpttqpppICYpgspdprcprpppsptptttpttpapLVCYPGSNDprcptrppppppppttprpttqpppICypgspdprcprpppsptptttpapicypGSNDprcpspppttprpttqpppVCYpgspdprcprpppsptpttpapLVCYPGSSDprcptrpppppppppttpappVCYPGSNDprcprptpttppppQCYLgspdprcprplpsspsppvcypgspdprcprppsptpEYVCYPGSIDPRCPRPPPTTQETYVCYPGSIDprcprpqppqpsptplcypgspdprcprppspsptptcypgspdprcrpsvpppTSQPFIPVGLTPFVCTCNVTTPRPIPPPLCYPGSTDPRCPREEIYPTQQIPSFCFPGSIDPRCPKPLRPSSTFQPETYLPPLPDSASEYSIKRDVGLNCHPGSNDPKCNEISIPPNNQKGGLLRTESSSLGKGEVHEALFQLNKELGLTDDKKEFAHFYRTPSPTTPAPPQCypgspdprcprpppspttpappqcypgspdprcprpplspttpappQCYPGSPDPWSQNTCLI

****VVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLKI******************************************************************************************************************************************************************************************************************************************************************************************************************VCY*****************TYVCY***************************************************************FIPVGLTPFVCTCNVTTPRPIPPPLCYPG*********EIYPTQQIPSFCFPG*********************************************************************************LFQLNKELGL******FAHF*****************************************************************************

***GVVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVI*****DRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDY*ASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILR***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************

SAQGVVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLKITTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPTRPP*************QPPPICYPGSPDPRCPRP*********PTTPAPLVCYPGSNDPRCPTRPP*************QPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPR**************PPPVCYPGSPDPRCPRPPPSPTPTTPAPLVCYPGS******************TPAPPVCYPGSNDPRCPRPTPTTPPPPQCYLGSPDPRCPRPLPSSPSPPVCYPGSPDPRCPRPPSPTPEYVCYPGSIDPRCPRPPPTTQETYVCYPGSIDPRCPRPQPPQPSPTPLCYPG********************************PPTSQPFIPVGLTPFVCTCNVTTPRPIPPPLCYPGSTDPRCPREEIYPTQQIPSFCFPGSIDPRCPKPLRPSSTFQPETYLPPLPDSASEYSIKRDVGLNCHPGSNDPKCNEISIPPNNQKGGLLRTESSSLGKGEVHEALFQLNKELGLTDDKKEFAHFYRTPSPTTPAPPQCYPGSPDPRCPRPPPSPTTPAPPQCYPGSPDPRCPRPPLSPTTPAPPQCYPGSPDPWSQNTCLI

****VVAPVLTVSVAQAVIALKARDRPVAPLVNQASEIHVHYFHQINFERTCALHPKGQFPTKANFLLKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITTYIQYNSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLK**************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		904	2.2.26 [Sep-21-2011]
Q9VCA9		179	Signal peptidase complex	no	N/A	0.129	0.653	0.674	5e-42
P61009		180	Signal peptidase complex	yes	N/A	0.118	0.594	0.609	1e-33
P61008		180	Signal peptidase complex	yes	N/A	0.118	0.594	0.609	1e-33
Q3SZU5		180	Signal peptidase complex	yes	N/A	0.118	0.594	0.609	1e-33
Q568Z4		180	Signal peptidase complex	no	N/A	0.118	0.594	0.572	2e-31
Q9D365		180	Signal peptidase complex	no	N/A	0.118	0.594	0.572	2e-31
P28687		180	Signal peptidase complex	yes	N/A	0.118	0.594	0.572	1e-30

>sp\|Q9VCA9\|SPCS3_DROME Signal peptidase complex subunit 3 OS=Drosophila melanogaster GN=Spase22-23 PE=2 SV=1	Back alignment and function desciption

 Score =  173 bits (439), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 83/123 (67%), Positives = 97/123 (78%), Gaps = 6/123 (4%)

Query: 160 NLLLCYKSNLIPITTYIQY----NSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANL 215
           ++L C   +    T ++ Y    N + VR  +L+KNVPDY ASRE++DLGF+TFDLQ NL
Sbjct: 17  SVLACLTFSCFLSTVFLDYRTDANINTVR--VLVKNVPDYGASREKHDLGFVTFDLQTNL 74

Query: 216 TKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGK 275
           T IFNWNVKQLFLYLTAEY TP+N LNQVVLWD+IILRG+NA L FKNMNTKYYFWDDG 
Sbjct: 75  TGIFNWNVKQLFLYLTAEYQTPANQLNQVVLWDKIILRGDNAVLDFKNMNTKYYFWDDGN 134

Query: 276 GLK 278
           GLK
Sbjct: 135 GLK 137

Microsomal signal peptidase is a membrane-bound endoproteinase that removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 4EC: .EC: -EC: .EC: -

>sp\|P61009\|SPCS3_HUMAN Signal peptidase complex subunit 3 OS=Homo sapiens GN=SPCS3 PE=1 SV=1	Back alignment and function description

>sp\|P61008\|SPCS3_CANFA Signal peptidase complex subunit 3 OS=Canis familiaris GN=SPCS3 PE=1 SV=1	Back alignment and function description

>sp\|Q3SZU5\|SPCS3_BOVIN Signal peptidase complex subunit 3 OS=Bos taurus GN=SPCS3 PE=2 SV=1	Back alignment and function description

>sp\|Q568Z4\|SPCS3_RAT Signal peptidase complex subunit 3 OS=Rattus norvegicus GN=Spcs3 PE=2 SV=1	Back alignment and function description

>sp\|Q9D365\|SPCS3_MOUSE Signal peptidase complex subunit 3 OS=Mus musculus GN=Spcs3 PE=2 SV=1	Back alignment and function description

>sp\|P28687\|SPCS3_CHICK Signal peptidase complex subunit 3 OS=Gallus gallus GN=SPC22 PE=1 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		904
357630156		1866	hypothetical protein KGM_14475 [Danaus p	0.871	0.422	0.359	7e-97
242006171		3220	conserved hypothetical protein [Pediculu	0.857	0.240	0.390	1e-89
195019099		2192	GH14786 [Drosophila grimshawi] gi\|193898	0.570	0.235	0.449	3e-80
195127890		2351	GI11840 [Drosophila mojavensis] gi\|19392	0.626	0.240	0.417	2e-76
195427587		2396	GK16962 [Drosophila willistoni] gi\|19415	0.577	0.217	0.441	5e-75
195377666		933	GJ13539 [Drosophila virilis] gi\|19415476	0.477	0.463	0.415	1e-70
194749683		2391	GF25319, isoform A [Drosophila ananassae	0.618	0.233	0.411	8e-67
198466742		2214	GA23353 [Drosophila pseudoobscura pseudo	0.641	0.261	0.386	2e-66
195495895		1042	GE19679 [Drosophila yakuba] gi\|194181562	0.706	0.613	0.357	1e-64
24667472		2284	zye [Drosophila melanogaster] gi\|7296302	0.605	0.239	0.399	1e-61

>gi\|357630156\|gb\|EHJ78480.1\| hypothetical protein KGM_14475 [Danaus plexippus]	Back alignment and taxonomy information

 Score =  362 bits (928), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 346/962 (35%), Positives = 453/962 (47%), Gaps = 174/962 (18%)

Query: 9   VLTVSVAQAVIALKARDRPVAPLVN-QASEIHVHYFHQINFERTCALHPKGQFPTKANFL 67
           ++  +    V + +A D P++P +N Q S   +    + +      ++ KG       +L
Sbjct: 65  IIDDTAVNFVRSSRAVDSPLSPDINVQCSADFIDVTVEFSDVYDGIIYSKG-------YL 117

Query: 68  LKPTSELQSHRVAQAVIALKARDRPVAPLIWINNSSPVRQNLLLCYKSNLIP-------- 119
             P  +  S   +Q+  + +   +        N    +  N+L+    + +         
Sbjct: 118 NDPKCKYVSLGGSQSRYSFRVPLKGCGSRSLCNACGTI-DNVLVFQADDFVQGPYDFARK 176

Query: 120 ---ITTYIQYNSSPVR--QNLLLCYKSNLIPITTYIQYNSSPVRQNLLLCYKSNLIPITT 174
               +T ++ +   VR  Q+ +L  K  ++ +   +            +  +  + P TT
Sbjct: 177 VSCASTALEVSVGGVRKEQSHILKLKPFMVDMLDVVAVQGPAGGVECWMDIQKGVFPNTT 236

Query: 175 YIQYN---SSPVRQNLLLKNVPDYSASREENDLGFITFDL------QANLTKIFNWNVKQ 225
            ++++      +   + LK+  +    +  +   +   D       +  LT       K+
Sbjct: 237 PLEHSIKIGEYLTILIYLKDTRNQFNLKIHDCWAYDNEDYDNPNTNKIQLTDKEGCPKKR 296

Query: 226 LFLYLTAEYITPSNVLNQVVLWDRI-ILRGENADLKFKNMNTKYYFWD-DGKGLKITTPR 283
            F+ L  +          ++ + ++   R    D  +   N +    D D     I  P 
Sbjct: 297 KFIDLFQKSTNTGKSGATLIAYSKVSAFRFPETDQVYLTCNVELCKSDCDSSCRDIIKPI 356

Query: 284 PTTQPPPI---CYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPTRPPPPPPPPTT 340
            TT+ P I   CYPGS DPRCPRP      TT  AP CYPGS DPRCP            
Sbjct: 357 TTTKKPQIIPSCYPGSTDPRCPRP------TTPEAPRCYPGSTDPRCP------------ 398

Query: 341 PRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPTTPAPLVCYPGSNDPRCPTRPPPPPPP 400
            +PTT  PP C+PGS DPRCPR          PTTP    CYPGSNDPRC          
Sbjct: 399 -QPTTPAPPKCFPGSTDPRCPR----------PTTPEAPRCYPGSNDPRC---------- 437

Query: 401 PTTPRPTTQPPPICYPGSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPSPPPTTPRPT 460
              P+PTT   P CYPGS D RCPR      PTT  AP CYPGS D RC       P+PT
Sbjct: 438 ---PKPTTPESPRCYPGSSDSRCPR------PTTPEAPRCYPGSTDTRC-------PQPT 481

Query: 461 TQPPPVCYPGSPDPRCPRPPPSPTPTTPAPLVCYPGSSDPRCPTRPPPPPPPPPTTPAPP 520
           T  PP C+PGS DPRCPR      PT+P    CYPGS+DPRCP          PTTP  P
Sbjct: 482 TPVPPKCFPGSTDPRCPR------PTSPESPRCYPGSTDPRCPQ---------PTTPEAP 526

Query: 521 VCYPGSNDPRCPRPTPTTPPPPQCYLGSPDPRCPRPLPSSPSPPVCYPGSPDPRCPRPPS 580
            CYPGS+DPRC R  PTTP  P+CY GS DPRC  P P++P+PP C+PGS DPRCPRP +
Sbjct: 527 SCYPGSSDPRCLR--PTTPEAPRCYPGSDDPRC--PKPTTPAPPKCFPGSTDPRCPRPTT 582

Query: 581 PTPEYVCYPGSIDPRCPRPPPTTQETYVCYPGSIDPRCPRPQPPQPSPTPLCYPGSPDPR 640
           P     CYPGS DPRCP+  PTT E+  CYPGS DPRCPRP  P+    P CYPGS DPR
Sbjct: 583 PEAPR-CYPGSNDPRCPK--PTTPESPRCYPGSSDPRCPRPTTPE---APRCYPGSSDPR 636

Query: 641 CPRPPSPSPTPTCYPGSPDPRC-RPSVP------PPTSQPFIPVGLTP-----FVCTCNV 688
           CP+P +P+P P C+PGS DPRC +P+ P      P +S P  P   TP     F  + + 
Sbjct: 637 CPKPTTPAP-PRCFPGSTDPRCPQPTTPEAPRCYPGSSDPRCPKPTTPAPPRCFPGSTDP 695

Query: 689 TTPRPIPP--PLCYPGSTDPRCPREEIYPTQQIPSFCFPGSIDPRCP-----------KP 735
             P+P  P  P CYPGS DPRCP+    PT   PS CFPGS DPRCP             
Sbjct: 696 RCPQPTTPEAPRCYPGSNDPRCPK----PTTPAPSKCFPGSSDPRCPGCGSRSLCNACGT 751

Query: 736 LRPSSTFQPETYLPPLPDSASEYSIKRDVGLNCHPGSNDPKCNEISIPPNNQKGGLLRTE 795
           +     FQ + ++    D A + S           G    + + + + P      +L   
Sbjct: 752 IDNVLVFQADDFVQGPYDFARKVSCASTALEVSVGGVRKEQSHILKLKPFMVD--MLDVV 809

Query: 796 SSSLGKGEVHEALFQLNK----ELGLTDDKKEFAHFYRTPSPTTPA-PPQCYPGSPDPRC 850
           +     G V E    + K     L  +D         +  + T P   P CYPGS DPRC
Sbjct: 810 AVQGPAGGV-ECWMDIQKGVFPNLCKSDCDSSCRDIIKPITTTKPQIIPSCYPGSTDPRC 868

Query: 851 PRPP----------------PSPTTPAPPQCYPGSPDPRCPRPPLSPTTPAPPQCYPGSP 894
           PRP                 P PTTP  P+CYPGS DPRCP+    PTTP  P+CYPGS 
Sbjct: 869 PRPTTTEAPRCYPGSTDSRCPQPTTPGSPRCYPGSNDPRCPK----PTTPESPRCYPGSS 924

Query: 895 DP 896
           DP
Sbjct: 925 DP 926

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|242006171\|ref\|XP_002423928.1\| conserved hypothetical protein [Pediculus humanus corporis] gi\|212507191\|gb\|EEB11190.1\| conserved hypothetical protein [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|195019099\|ref\|XP_001984908.1\| GH14786 [Drosophila grimshawi] gi\|193898390\|gb\|EDV97256.1\| GH14786 [Drosophila grimshawi]	Back alignment and taxonomy information

>gi\|195127890\|ref\|XP_002008400.1\| GI11840 [Drosophila mojavensis] gi\|193920009\|gb\|EDW18876.1\| GI11840 [Drosophila mojavensis]	Back alignment and taxonomy information

>gi\|195427587\|ref\|XP_002061858.1\| GK16962 [Drosophila willistoni] gi\|194157943\|gb\|EDW72844.1\| GK16962 [Drosophila willistoni]	Back alignment and taxonomy information

>gi\|195377666\|ref\|XP_002047609.1\| GJ13539 [Drosophila virilis] gi\|194154767\|gb\|EDW69951.1\| GJ13539 [Drosophila virilis]	Back alignment and taxonomy information

>gi\|194749683\|ref\|XP_001957268.1\| GF25319, isoform A [Drosophila ananassae] gi\|190624550\|gb\|EDV40074.1\| GF25319, isoform A [Drosophila ananassae]	Back alignment and taxonomy information

>gi\|198466742\|ref\|XP_002135249.1\| GA23353 [Drosophila pseudoobscura pseudoobscura] gi\|198150736\|gb\|EDY73876.1\| GA23353 [Drosophila pseudoobscura pseudoobscura]	Back alignment and taxonomy information

>gi\|195495895\|ref\|XP_002095461.1\| GE19679 [Drosophila yakuba] gi\|194181562\|gb\|EDW95173.1\| GE19679 [Drosophila yakuba]	Back alignment and taxonomy information

>gi\|24667472\|ref\|NP_649220.1\| zye [Drosophila melanogaster] gi\|7296302\|gb\|AAF51592.1\| zye [Drosophila melanogaster]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		904
FB\|FBgn0039172		179	Spase22-23 "Spase 22/23-subuni	0.129	0.653	0.674	8.7e-40
UNIPROTKB\|Q3SZU5		180	SPCS3 "Signal peptidase comple	0.118	0.594	0.609	1.7e-31
UNIPROTKB\|P61008		180	SPCS3 "Signal peptidase comple	0.118	0.594	0.609	1.7e-31
UNIPROTKB\|P61009		180	SPCS3 "Signal peptidase comple	0.118	0.594	0.609	1.7e-31
UNIPROTKB\|F2Z5C8		180	SPCS3 "Uncharacterized protein	0.118	0.594	0.609	1.7e-31
UNIPROTKB\|F1MMC0		181	F1MMC0 "Uncharacterized protei	0.117	0.585	0.596	1.1e-30
ZFIN\|ZDB-GENE-040426-2206		180	spcs3 "signal peptidase comple	0.118	0.594	0.581	3e-30
RGD\|1563536		180	MGC109340 "similar to Microsom	0.118	0.594	0.572	1.4e-29
UNIPROTKB\|F1PXY0		163	SPCS3 "Signal peptidase comple	0.118	0.656	0.581	3.1e-29
UNIPROTKB\|P28687		180	SPC22 "Signal peptidase comple	0.118	0.594	0.572	8.6e-29

FB\|FBgn0039172 Spase22-23 "Spase 22/23-subunit" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 424 (154.3 bits), Expect = 8.7e-40, P = 8.7e-40
 Identities = 83/123 (67%), Positives = 97/123 (78%)

Query:   160 NLLLCYKSNLIPITTYIQY----NSSPVRQNLLLKNVPDYSASREENDLGFITFDLQANL 215
             ++L C   +    T ++ Y    N + VR  +L+KNVPDY ASRE++DLGF+TFDLQ NL
Sbjct:    17 SVLACLTFSCFLSTVFLDYRTDANINTVR--VLVKNVPDYGASREKHDLGFVTFDLQTNL 74

Query:   216 TKIFNWNVKQLFLYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGK 275
             T IFNWNVKQLFLYLTAEY TP+N LNQVVLWD+IILRG+NA L FKNMNTKYYFWDDG 
Sbjct:    75 TGIFNWNVKQLFLYLTAEYQTPANQLNQVVLWDKIILRGDNAVLDFKNMNTKYYFWDDGN 134

Query:   276 GLK 278
             GLK
Sbjct:   135 GLK 137

GO:0005787 "signal peptidase complex" evidence=ISS;NAS

GO:0006465 "signal peptide processing" evidence=ISS;NAS

GO:0008233 "peptidase activity" evidence=ISS;NAS

GO:0016021 "integral to membrane" evidence=IEA

UNIPROTKB\|Q3SZU5 SPCS3 "Signal peptidase complex subunit 3" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|P61008 SPCS3 "Signal peptidase complex subunit 3" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P61009 SPCS3 "Signal peptidase complex subunit 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F2Z5C8 SPCS3 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MMC0 F1MMC0 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-040426-2206 spcs3 "signal peptidase complex subunit 3 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

RGD\|1563536 MGC109340 "similar to Microsomal signal peptidase 23 kDa subunit (SPase 22 kDa subunit) (SPC22/23)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|F1PXY0 SPCS3 "Signal peptidase complex subunit 3" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|P28687 SPC22 "Signal peptidase complex subunit 3" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
P28687	SPCS3_CHICK	3, ., 4, ., -, ., -	0.5727	0.1183	0.5944	yes	N/A
Q3SZU5	SPCS3_BOVIN	3, ., 4, ., -, ., -	0.6090	0.1183	0.5944	yes	N/A
P61009	SPCS3_HUMAN	3, ., 4, ., -, ., -	0.6090	0.1183	0.5944	yes	N/A
P61008	SPCS3_CANFA	3, ., 4, ., -, ., -	0.6090	0.1183	0.5944	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		904
pfam04573		175	pfam04573, SPC22, Signal peptidase subunit	8e-55
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	3e-30
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	3e-30
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	4e-30
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	2e-28
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	2e-24
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	6e-24
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	9e-18
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	3e-17
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	3e-15
PTZ00116		185	PTZ00116, PTZ00116, signal peptidase; Provisional	2e-14
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	7e-13
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	8e-13
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	9e-13
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	5e-12
PRK07003		830	PRK07003, PRK07003, DNA polymerase III subunits ga	9e-12
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	2e-11
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-11
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	3e-11
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	5e-11
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	6e-11
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-10
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	9e-10
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	2e-09
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	4e-09
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	7e-09
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	1e-08
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	1e-08
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	3e-08
PHA03378		991	PHA03378, PHA03378, EBNA-3B; Provisional	4e-08
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	5e-08
PRK07003		830	PRK07003, PRK07003, DNA polymerase III subunits ga	6e-08
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	7e-08
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	1e-07
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	1e-07
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	2e-07
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	2e-07
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	3e-07
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	3e-07
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	3e-07
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	3e-07
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	3e-07
pfam03154		979	pfam03154, Atrophin-1, Atrophin-1 family	3e-07
pfam04652		315	pfam04652, DUF605, Vta1 like	3e-07
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	4e-07
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	5e-07
pfam03154		979	pfam03154, Atrophin-1, Atrophin-1 family	5e-07
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	5e-07
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	6e-07
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	7e-07
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	7e-07
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	9e-07
PLN03209		576	PLN03209, PLN03209, translocon at the inner envelo	9e-07
PRK07003		830	PRK07003, PRK07003, DNA polymerase III subunits ga	1e-06
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	1e-06
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-06
pfam03154		979	pfam03154, Atrophin-1, Atrophin-1 family	2e-06
pfam04652		315	pfam04652, DUF605, Vta1 like	2e-06
pfam04652		315	pfam04652, DUF605, Vta1 like	2e-06
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	3e-06
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	3e-06
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	3e-06
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	3e-06
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	3e-06
pfam04652		315	pfam04652, DUF605, Vta1 like	3e-06
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	4e-06
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	4e-06
pfam04652		315	pfam04652, DUF605, Vta1 like	4e-06
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	5e-06
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	5e-06
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	6e-06
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	7e-06
PHA03378		991	PHA03378, PHA03378, EBNA-3B; Provisional	8e-06
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	8e-06
PTZ00449		943	PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti	9e-06
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	1e-05
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	1e-05
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	1e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	2e-05
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	2e-05
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	2e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	3e-05
pfam04652		315	pfam04652, DUF605, Vta1 like	3e-05
PLN03209		576	PLN03209, PLN03209, translocon at the inner envelo	3e-05
PLN03209		576	PLN03209, PLN03209, translocon at the inner envelo	3e-05
PLN03209		576	PLN03209, PLN03209, translocon at the inner envelo	3e-05
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	4e-05
PLN03209		576	PLN03209, PLN03209, translocon at the inner envelo	4e-05
PTZ00449		943	PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti	4e-05
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	4e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	5e-05
PHA03378		991	PHA03378, PHA03378, EBNA-3B; Provisional	5e-05
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	5e-05
PLN03209		576	PLN03209, PLN03209, translocon at the inner envelo	5e-05
PTZ00449		943	PTZ00449, PTZ00449, 104 kDa microneme/rhoptry anti	5e-05
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	5e-05
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	6e-05
PRK14086		617	PRK14086, dnaA, chromosomal replication initiation	6e-05
PHA03321		694	PHA03321, PHA03321, tegument protein VP11/12; Prov	6e-05
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	7e-05
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	7e-05
PHA03132		580	PHA03132, PHA03132, thymidine kinase; Provisional	7e-05
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	1e-04
pfam04652		315	pfam04652, DUF605, Vta1 like	1e-04
PHA03377		1000	PHA03377, PHA03377, EBNA-3C; Provisional	1e-04
pfam03153		332	pfam03153, TFIIA, Transcription factor IIA, alpha/	1e-04
PRK03427		333	PRK03427, PRK03427, cell division protein ZipA; Pr	1e-04
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	2e-04
PRK12323		700	PRK12323, PRK12323, DNA polymerase III subunits ga	2e-04
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	2e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	2e-04
pfam09770		804	pfam09770, PAT1, Topoisomerase II-associated prote	2e-04
PHA03377		1000	PHA03377, PHA03377, EBNA-3C; Provisional	2e-04
pfam05518		753	pfam05518, Totivirus_coat, Totivirus coat protein	2e-04
PRK14951		618	PRK14951, PRK14951, DNA polymerase III subunits ga	3e-04
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	3e-04
PRK03427		333	PRK03427, PRK03427, cell division protein ZipA; Pr	3e-04
PRK14950		585	PRK14950, PRK14950, DNA polymerase III subunits ga	4e-04
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	4e-04
PHA03132		580	PHA03132, PHA03132, thymidine kinase; Provisional	4e-04
pfam05518		753	pfam05518, Totivirus_coat, Totivirus coat protein	4e-04
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	4e-04
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	5e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	5e-04
PRK07994		647	PRK07994, PRK07994, DNA polymerase III subunits ga	6e-04
PRK03427		333	PRK03427, PRK03427, cell division protein ZipA; Pr	6e-04
PRK12727		559	PRK12727, PRK12727, flagellar biosynthesis regulat	6e-04
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	6e-04
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	7e-04
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	7e-04
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	7e-04
PRK15313		955	PRK15313, PRK15313, autotransport protein MisL; Pr	7e-04
PRK09752		1250	PRK09752, PRK09752, adhesin; Provisional	7e-04
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	8e-04
PRK10263		1355	PRK10263, PRK10263, DNA translocase FtsK; Provisio	8e-04
PHA03247		3151	PHA03247, PHA03247, large tegument protein UL36; P	0.001
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	0.001
PRK07764		824	PRK07764, PRK07764, DNA polymerase III subunits ga	0.001
pfam04652		315	pfam04652, DUF605, Vta1 like	0.001
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	0.001
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	0.001
PRK12270		1228	PRK12270, kgd, alpha-ketoglutarate decarboxylase;	0.001
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	0.001
PRK09752		1250	PRK09752, PRK09752, adhesin; Provisional	0.001
PRK06995		484	PRK06995, flhF, flagellar biosynthesis regulator F	0.001
PRK14965		576	PRK14965, PRK14965, DNA polymerase III subunits ga	0.001
pfam03154		979	pfam03154, Atrophin-1, Atrophin-1 family	0.002
PRK14971		614	PRK14971, PRK14971, DNA polymerase III subunits ga	0.002
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	0.002
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	0.002
PRK14965		576	PRK14965, PRK14965, DNA polymerase III subunits ga	0.002
PHA03269		566	PHA03269, PHA03269, envelope glycoprotein C; Provi	0.002
pfam13388		422	pfam13388, DUF4106, Protein of unknown function (D	0.002
PHA03132		580	PHA03132, PHA03132, thymidine kinase; Provisional	0.003
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	0.003
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	0.003
PHA03307		1352	PHA03307, PHA03307, transcriptional regulator ICP4	0.004
PHA03132		580	PHA03132, PHA03132, thymidine kinase; Provisional	0.004
PRK14948		620	PRK14948, PRK14948, DNA polymerase III subunits ga	0.004
pfam13388		422	pfam13388, DUF4106, Protein of unknown function (D	0.004
PRK14954		620	PRK14954, PRK14954, DNA polymerase III subunits ga	0.004

>gnl\|CDD\|191032 pfam04573, SPC22, Signal peptidase subunit	Back alignment and domain information

 Score =  187 bits (476), Expect = 8e-55
 Identities = 62/110 (56%), Positives = 78/110 (70%), Gaps = 3/110 (2%)

Query: 172 ITTYIQYNSSPVR---QNLLLKNVPDYSASREENDLGFITFDLQANLTKIFNWNVKQLFL 228
           ++T     S           +++V D+   R++NDLGF+TFDL A+L+ +FNWN KQLF+
Sbjct: 28  LSTVFNDYSVSASISVVKAKVRSVRDFGNRRKKNDLGFLTFDLSADLSPLFNWNTKQLFV 87

Query: 229 YLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLK 278
           YLTAEY TP N LNQVVLWD+IILR ENA L  K+M +KYYFWDDG GLK
Sbjct: 88  YLTAEYETPENALNQVVLWDKIILRKENAKLDLKDMKSKYYFWDDGNGLK 137

Translocation of polypeptide chains across the endoplasmic reticulum membrane is triggered by signal sequences. During translocation of the nascent chain through the membrane, the signal sequence of most secretory and membrane proteins is cleaved off. Cleavage occurs by the signal peptidase complex (SPC) which consists of four subunits in yeast and five in mammals. This family is common to yeast and mammals. Length = 175

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|173408 PTZ00116, PTZ00116, signal peptidase; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223065 PHA03378, PHA03378, EBNA-3B; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|217393 pfam03154, Atrophin-1, Atrophin-1 family	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|217393 pfam03154, Atrophin-1, Atrophin-1 family	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>gnl\|CDD\|235906 PRK07003, PRK07003, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|217393 pfam03154, Atrophin-1, Atrophin-1 family	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|223065 PHA03378, PHA03378, EBNA-3B; Provisional	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>gnl\|CDD\|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>gnl\|CDD\|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>gnl\|CDD\|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|223065 PHA03378, PHA03378, EBNA-3B; Provisional	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|178748 PLN03209, PLN03209, translocon at the inner envelope of chloroplast subunit 62; Provisional	Back alignment and domain information

>gnl\|CDD\|185628 PTZ00449, PTZ00449, 104 kDa microneme/rhoptry antigen; Provisional	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223041 PHA03321, PHA03321, tegument protein VP11/12; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|222997 PHA03132, PHA03132, thymidine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|177614 PHA03377, PHA03377, EBNA-3C; Provisional	Back alignment and domain information

>gnl\|CDD\|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit	Back alignment and domain information

>gnl\|CDD\|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1	Back alignment and domain information

>gnl\|CDD\|177614 PHA03377, PHA03377, EBNA-3C; Provisional	Back alignment and domain information

>gnl\|CDD\|218621 pfam05518, Totivirus_coat, Totivirus coat protein	Back alignment and domain information

>gnl\|CDD\|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional	Back alignment and domain information

>gnl\|CDD\|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|222997 PHA03132, PHA03132, thymidine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|218621 pfam05518, Totivirus_coat, Totivirus coat protein	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional	Back alignment and domain information

>gnl\|CDD\|237182 PRK12727, PRK12727, flagellar biosynthesis regulator FlhF; Provisional	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237940 PRK15313, PRK15313, autotransport protein MisL; Provisional	Back alignment and domain information

>gnl\|CDD\|182059 PRK09752, PRK09752, adhesin; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional	Back alignment and domain information

>gnl\|CDD\|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated	Back alignment and domain information

>gnl\|CDD\|218191 pfam04652, DUF605, Vta1 like	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|237030 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|182059 PRK09752, PRK09752, adhesin; Provisional	Back alignment and domain information

>gnl\|CDD\|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated	Back alignment and domain information

>gnl\|CDD\|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|217393 pfam03154, Atrophin-1, Atrophin-1 family	Back alignment and domain information

>gnl\|CDD\|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|165527 PHA03269, PHA03269, envelope glycoprotein C; Provisional	Back alignment and domain information

>gnl\|CDD\|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106)	Back alignment and domain information

>gnl\|CDD\|222997 PHA03132, PHA03132, thymidine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional	Back alignment and domain information

>gnl\|CDD\|222997 PHA03132, PHA03132, thymidine kinase; Provisional	Back alignment and domain information

>gnl\|CDD\|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

>gnl\|CDD\|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106)	Back alignment and domain information

>gnl\|CDD\|184918 PRK14954, PRK14954, DNA polymerase III subunits gamma and tau; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		904
PTZ00116		185	signal peptidase; Provisional	100.0
PF04573		175	SPC22: Signal peptidase subunit; InterPro: IPR0076	100.0
KOG3372\|consensus		176		100.0

>PTZ00116 signal peptidase; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.4e-35  Score=292.26  Aligned_cols=124  Identities=31%  Similarity=0.471  Sum_probs=108.1

Q ss_pred             ccccceeeeeeccc-------ceeeeecccCCCCceeeEEEeeecCcc-cCcCccceEEEEEEccCCCcccccccceeEE
Q psy15615        156 PVRQNLLLCYKSNL-------IPITTYIQYNSSPVRQNLLLKNVPDYS-ASREENDLGFITFDLQANLTKIFNWNVKQLF  227 (904)
Q Consensus       156 ~~~~~~~~c~~s~l-------~AlST~f~~~s~PV~~~V~VknV~~f~-ssr~~~D~A~ItFDLdADLSpLFNWNTKQLF  227 (904)
                      -.|-|.+|||...+       ..+|++|++...++.++|+|+||++|. .+.+++|+|+|+|||+|||+++|||||||||
T Consensus         5 ~~R~Nal~~f~~~vLa~l~~~~~~s~~f~~~~~~~~~~i~v~~V~~~~~~~~~~~D~a~i~fdl~~DL~~lfnWNtKqlF   84 (185)
T PTZ00116          5 LNRLNVLSYSMALCFLILCLFNYGTSFYLFDEKEMSTNIKVKSVKRLVYNRHIKGDEAVLSLDLSYDMSKAFNWNLKQLF   84 (185)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhHhhccCCCCceeeEEEeecccccccCCCCceeEEEEEeeccCchhcCCccccEEE
Confidence            35667777654322       234677765666676789999999996 5667899999999999999999999999999


Q ss_pred             EEEEEEEeCCCCCcceEEEEccccccCCccccccccccceeecCCCCCCCCc
Q psy15615        228 LYLTAEYITPSNVLNQVVLWDRIILRGENADLKFKNMNTKYYFWDDGKGLKI  279 (904)
Q Consensus       228 VYLtAEYeT~kn~lNQVVIWDKII~rkEdAkL~LkniksKY~fsDDprcLk~  279 (904)
                      |||+|||+++++.+|||||||+||++||+|+|+++++++||.|||+|++|+.
T Consensus        85 vyv~a~Y~t~~~~~n~v~iWD~Ii~~k~~A~l~~~~~~~KY~l~D~~~~Lrg  136 (185)
T PTZ00116         85 LYVLVTYETPEKVKNEVIIQDYIITNKKQAKKTYKNFITKYSLKDYNNGLRN  136 (185)
T ss_pred             EEEEEEEcCCCCccccEEEEeeeecCcccceEeecccccceeEEeCCCCccC
Confidence            9999999999999999999999999999999999999999999999999975

>PF04573 SPC22: Signal peptidase subunit; InterPro: IPR007653 Translocation of polypeptide chains across the endoplasmic reticulum membrane is triggered by signal sequences	Back alignment and domain information

>KOG3372\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		904
1twf_A		1733	B220, DNA-directed RNA polymerase II largest subun	1e-14
1twf_A		1733	B220, DNA-directed RNA polymerase II largest subun	5e-13
1twf_A		1733	B220, DNA-directed RNA polymerase II largest subun	4e-10
1twf_A		1733	B220, DNA-directed RNA polymerase II largest subun	5e-10
3h0g_A		1752	DNA-directed RNA polymerase II subunit RPB1; trans	4e-14
3h0g_A		1752	DNA-directed RNA polymerase II subunit RPB1; trans	5e-13
3h0g_A		1752	DNA-directed RNA polymerase II subunit RPB1; trans	1e-12
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	5e-10
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	6e-09
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	3e-08
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	4e-08
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	1e-07
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	3e-07
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	4e-06
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	6e-06
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	9e-06
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	1e-05
3v1v_A		433	2-MIB synthase, 2-methylisoborneol synthase; class	8e-05
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	8e-10
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	2e-09
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	4e-07
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	3e-06
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	2e-05
3gdb_A		937	Endo-D, putative uncharacterized protein SPR0440;	7e-04
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	1e-09
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	1e-08
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	3e-08
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	2e-07
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	2e-06
1m2v_B		926	SEC24, protein transport protein SEC24, SEC24P, SE	6e-05
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	1e-07
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	2e-07
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	3e-07
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	3e-06
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	8e-06
1deq_A		390	Fibrinogen (alpha chain); coiled-coil, blood clott	1e-04
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	3e-07
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	5e-07
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	2e-05
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	8e-05
3iox_A		497	AGI/II, PA; alpha helix, PPII helix, supersandwich	2e-04
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	2e-06
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	2e-05
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	3e-05
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	5e-05
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	6e-05
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	4e-04
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	4e-04
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	4e-04
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	5e-04
2wvr_C		546	DNA replication factor CDT1; DNA replication licen	6e-04
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-05
1pk8_A		422	RAT synapsin I; ATP binding, ATP grAsp, calcium (I	4e-05
3tx7_B		352	Nuclear receptor subfamily 5 group A member 2; LRH	8e-05
3dzy_A		467	Retinoic acid receptor RXR-alpha; DNA-binding, HOS	8e-05
3dzy_A		467	Retinoic acid receptor RXR-alpha; DNA-binding, HOS	2e-04
3dzy_A		467	Retinoic acid receptor RXR-alpha; DNA-binding, HOS	2e-04
3dzy_A		467	Retinoic acid receptor RXR-alpha; DNA-binding, HOS	4e-04
3dzy_A		467	Retinoic acid receptor RXR-alpha; DNA-binding, HOS	6e-04
3dzy_A		467	Retinoic acid receptor RXR-alpha; DNA-binding, HOS	8e-04
3nwa_A		703	GB, GB-1, GB1, envelope glycoprotein B; coiled-coi	9e-05
3nwa_A		703	GB, GB-1, GB1, envelope glycoprotein B; coiled-coi	2e-04
3nwa_A		703	GB, GB-1, GB1, envelope glycoprotein B; coiled-coi	3e-04
3nwa_A		703	GB, GB-1, GB1, envelope glycoprotein B; coiled-coi	6e-04
3nwa_A		703	GB, GB-1, GB1, envelope glycoprotein B; coiled-coi	8e-04
1w7p_D		566	VPS36P, YLR417W; ESCRT-II complex, endosomal prote	3e-04
1w7p_D		566	VPS36P, YLR417W; ESCRT-II complex, endosomal prote	7e-04
1w7p_D		566	VPS36P, YLR417W; ESCRT-II complex, endosomal prote	9e-04

>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733	Back alignment and structure

 Score = 77.4 bits (190), Expect = 1e-14
 Identities = 62/316 (19%), Positives = 86/316 (27%), Gaps = 38/316 (12%)

Query: 357  DPRCPRPPPSPTPTTTPTTPAPLVCYPGSNDPRCPTRPPPPPPPPTTPRPTTQPPPICYP 416
            +    +  P    T         V    +                 +P   +        
Sbjct: 1447 EESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAG 1506

Query: 417  GSPDPRCPRPPPSPTPTTTPAPICYPGSNDPRCPSPPPTTPRPTTQPPPVCYPGSPDPRC 476
            G           + +P              P  P    ++P  +        P SP    
Sbjct: 1507 GFTAYGGADYGEATSPFGAYGE-------APTSPGFGVSSPGFS--------PTSPTYSP 1551

Query: 477  PRPPPSPT-----PTTPAPLVCYPGSSDPRCPTRPPPPPPPPPTTPAPPVCYPGSNDPRC 531
              P  SPT     PT+P+     P  S    PT P   P  P  +P  P   P S     
Sbjct: 1552 TSPAYSPTSPSYSPTSPSYSPTSPSYS----PTSPSYSPTSPSYSPTSPSYSPTS----- 1602

Query: 532  PRPTPTTPPP----PQCYLGSPDPRCPRPLPSSPSPPVCYPGSPDPRCPRPPSPTPEYVC 587
            P  +PT+P      P     SP      P  S  SP   Y  +     P  PS +P    
Sbjct: 1603 PSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPS--YSPTSPSYSPTSPSYSPTSPA 1660

Query: 588  YPGSIDPRCPRPPPTTQETYVCYPGSIDPRCPRPQPPQPSPTPLCYPGSPDPRCPRPPSP 647
            Y  +     P  P  +  +    P S       P  P  SPT   Y  +     P  P+ 
Sbjct: 1661 YSPTSPSYSPTSPSYSPTSPSYSPTS---PSYSPTSPNYSPTSPSYSPTSPGYSPGSPAY 1717

Query: 648  SPTPTCYPGSPDPRCR 663
            SP       + +   R
Sbjct: 1718 SPKQDEQKHNENENSR 1733

PyMOL of 1twf

>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733	Back alignment and structure

>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733	Back alignment and structure

>1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733	Back alignment and structure

>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752	Back alignment and structure

>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752	Back alignment and structure

>3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497	Back alignment and structure

>3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546	Back alignment and structure

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422	Back alignment and structure

>3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352	Back alignment and structure

>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467	Back alignment and structure

>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467	Back alignment and structure

>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467	Back alignment and structure

>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467	Back alignment and structure

>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467	Back alignment and structure

>3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467	Back alignment and structure

>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703	Back alignment and structure

>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703	Back alignment and structure

>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703	Back alignment and structure

>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703	Back alignment and structure

>3nwa_A GB, GB-1, GB1, envelope glycoprotein B; coiled-coil, membrane fusion, viral P glycoprotein B, HSV-1, membrane; HET: NAG; 2.26A {Human herpesvirus 1} PDB: 3nwf_A* 3nw8_A* 3nwd_A* Length = 703	Back alignment and structure

>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566	Back alignment and structure

>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566	Back alignment and structure

>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

No hit with probability above 80.00

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00