Diaphorina citri psyllid: psy1561

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-----
IVRPNSALLVIDVQNDFISGTLNLSQCSAKQNGLQALFRNDKGKIYALKDNELEETFAVFDLNQDGLIDREEFAFCWNRWIKVVIEPINKLLDTVNFNAVFYSLDWHPSNHVSFIDNIKLRKIHHTSTIQPEDAQTYDTVVFDGDTPIRQRLWPRHCVQDSWGAELHKDLKVVDNAIKVYKGTDPEVDSYSVFWDNKKLKGTSLAKQLEAKKVTDVYVCGLAYDVCVGASAIDAITIGYRTILIEDCCRGVDMDDMERTRNTILENYGSCVQSDEVLGQHENTRK
ccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHcccccEEEEEcccccccccccccccccccccccccccccccccccCEEcccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccHHHHHHHccccEEEEEEEccHHHHHHHHHHHHHcccEEEEEcccEEECccccHHHHHHHHHHcccEEEEcHHHHHHHccccc
***PNSALLVIDVQNDFISGTLNLSQCSAKQNGLQALFRNDKGKIYALKDNELEETFAVFDLNQDGLIDREEFAFCWNRWIKVVIEPINKLLDTVNFNAVFYSLDWHPSNHVSFIDNIKLRKIHHTSTIQPEDAQTYDTVVFDGDTPIRQRLWPRHCVQDSWGAELHKDLKVVDNAIKVYKGTDPEVDSYSVFWDNKKLKGTSLAKQLEAKKVTDVYVCGLAYDVCVGASAIDAITIGYRTILIEDCCRGVDMDDMERTRNTILENYGSCVQSDEV*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IVRPNSALLVIDVQNDFISGTLNLSQCSAKQNGLQALFRNDKGKIYALKDNELEETFAVFDLNQDGLIDREEFAFCWNRWIKVVIEPINKLLDTVNFNAVFYSLDWHPSNHVSFIDNIKLRKIHHTSTIQPEDAQTYDTVVFDGDTPIRQRLWPRHCVQDSWGAELHKDLKVVDNAIKVYKGTDPEVDSYSVFWDNKKLKGTSLAKQLEAKKVTDVYVCGLAYDVCVGASAIDAITIGYRTILIEDCCRGVDMDDMERTRNTILENYGSCVQSDEVLGQHENTRK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043524 [BP]negative regulation of neuron apoptotic processprobableGO:0010941, GO:0060548, GO:0043066, GO:0050794, GO:0008150, GO:0043067, GO:0043523, GO:0065007, GO:0048523, GO:0048519, GO:1901214, GO:1901215, GO:0042981, GO:0050789, GO:0043069
GO:0008936 [MF]nicotinamidase activityprobableGO:0016787, GO:0016810, GO:0016811, GO:0003674, GO:0003824
GO:0006769 [BP]nicotinamide metabolic processprobableGO:0006767, GO:0006766, GO:1901564, GO:0043603, GO:0009820, GO:0009987, GO:0044710, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0072524, GO:1901360, GO:0046483
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1IM5, chain A
Confidence level:very confident
Coverage over the Query: 4-28,83-117,150-272
View the alignment between query and template
View the model in PyMOL
Template: 2WT9, chain A
Confidence level:very confident
Coverage over the Query: 3-28,83-122,136-277
View the alignment between query and template
View the model in PyMOL
Template: 2HPS, chain A
Confidence level:probable
Coverage over the Query: 52-145
View the alignment between query and template
View the model in PyMOL
Template: 2BEC, chain A
Confidence level:probable
Coverage over the Query: 15-73
View the alignment between query and template
View the model in PyMOL