Diaphorina citri psyllid: psy15639

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
PKSDKPAARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRAQPVLSQNSTDSLLDVPVLEALQRRHSDVKIGSANSGAHPANQGLAPPRSPELRRHSDVSPASLKELE
cccccccccccccHHHcccccccccccHHHHHHHHHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccccccHHHccccccccccccccc
***********NCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKL*E***ENTWRCSICRRKLQ*****************VPVLEA***********************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PKSDKPAARLGNCRVCLKSFKPDDYSRVCYECHQKVCEDCASYSKLDENQDENTWRCSICRRKLQSRAQPVLSQNSTDSLLDVPVLEALQRRHSDVKIGSANSGAHPANQGLAPPRSPELRRHSDVSPASLKELE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfer were detected in SWISS-PROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048786 [CC]presynaptic active zoneprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0044456, GO:0045202
GO:2000809 [BP]positive regulation of synaptic vesicle clusteringprobableGO:0051130, GO:0032879, GO:0060341, GO:0050794, GO:0051128, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:1901629, GO:2000807, GO:1901631, GO:0048522
GO:0001956 [BP]positive regulation of neurotransmitter secretionprobableGO:0060341, GO:0051047, GO:0051049, GO:0050804, GO:0023051, GO:0051588, GO:0010646, GO:0050789, GO:0051046, GO:0044057, GO:0065007, GO:0048518, GO:0051050, GO:0050794, GO:0051590, GO:0046928, GO:0008150, GO:0051239, GO:0032879, GO:0031644, GO:0051969, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LRQ, chain A
Confidence level:confident
Coverage over the Query: 11-66,78-98
View the alignment between query and template
View the model in PyMOL