Diaphorina citri psyllid: psy1563


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MEGEEREKENLYKFKGPNPNTKLSLSTNLIEKISGLMSLKKLRILALGRNMIKTFTGLEPLGDCLEELWISYNFIEKTKGIGSLKKLKVLYMCHNSVKEWGELNKINDCPVLEDLVFCGNPIVENLEESAYRVEIKKRLPRLKKLDGEVLPE
cccccccccccccccccccccEEEcccccccEEEcccccccccEEEccccccccccccccccccccEEEcccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccHHHHHHHHHHcccccccccccccc
****EREKENLYKFKGPNPNTKLSLSTNLIEKISGLMSLKKLRILALGRNMIKTFTGLEPLGDCLEELWISYNFIEKTKGIGSLKKLKVLYMCHNSVKEWGELNKINDCPVLEDLVFCGNPIVENLEESAYRVEIKKRLPRLKKLDGEVLP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGEEREKENLYKFKGPNPNTKLSLSTNLIEKISGLMSLKKLRILALGRNMIKTFTGLEPLGDCLEELWISYNFIEKTKGIGSLKKLKVLYMCHNSVKEWGELNKINDCPVLEDLVFCGNPIVENLEESAYRVEIKKRLPRLKKLDGEVLPE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynein light chain 1, axonemal confidentQ4LDG9
Dynein light chain 1, axonemal confidentQ28G94
Dynein light chain 1, axonemal confidentQ05A62

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016020 [CC]membraneprobableGO:0005575
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1O6V, chain A
Confidence level:very confident
Coverage over the Query: 14-146
View the alignment between query and template
View the model in PyMOL
Template: 1A9N, chain A
Confidence level:very confident
Coverage over the Query: 6-150
View the alignment between query and template
View the model in PyMOL