Diaphorina citri psyllid: psy15652


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MEEEEEDAVTGIKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGKGVWIPGLLKKSRKFVNKKCSSLVTRLEIWYVAVKCDKDVTFG
cccHHHHHHcccEEEEECcccccccccHHHHHHHccccccccEEEEEccccccccccccccccccccccccEEcccccEEEEEEcccccccc
*EEEEEDAVTGIKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGKGVWIPGLLKKSRKFVNKKCSSLVTRLEIWYVAVKCDKDVTF*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEEEEEDAVTGIKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGKGVWIPGLLKKSRKFVNKKCSSLVTRLEIWYVAVKCDKDVTFG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Oligo-1,6-glucosidase confidentP29094
Maltase A3 confidentP07192
Oligo-1,6-glucosidase 1 Hydrolyzes various disaccharides such as sucrose, maltose, and isomaltose with different efficiencies. Also hydrolyzes longer maltodextrins from maltotriose up to maltohexaose, but not maltoheptaose, palatinose, isomaltotriose, or isomaltotetraose.confidentO06994

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005622 [CC]intracellularprobableGO:0005575, GO:0044464, GO:0005623
GO:0046352 [BP]disaccharide catabolic processprobableGO:0044275, GO:0044238, GO:1901575, GO:0044262, GO:0071704, GO:0005984, GO:0009987, GO:0009311, GO:0009313, GO:0016052, GO:0008150, GO:0044237, GO:0008152, GO:0044723, GO:0005975, GO:0009056, GO:0044724
GO:0032450 [MF]maltose alpha-glucosidase activityprobableGO:0015926, GO:0016787, GO:0016798, GO:0003824, GO:0003674, GO:0004553, GO:0004558
GO:0004575 [MF]sucrose alpha-glucosidase activityprobableGO:0015926, GO:0016787, GO:0016798, GO:0003824, GO:0003674, GO:0004564, GO:0004553, GO:0004558

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K8K, chain A
Confidence level:very confident
Coverage over the Query: 2-48
View the alignment between query and template
View the model in PyMOL
Template: 1G5A, chain A
Confidence level:very confident
Coverage over the Query: 2-91
View the alignment between query and template
View the model in PyMOL