Psyllid ID: psy15652
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| 350415025 | 575 | PREDICTED: alpha-glucosidase-like isofor | 0.434 | 0.069 | 0.675 | 3e-10 | |
| 260268379 | 575 | alpha-glucosidase [Bombus ignitus] | 0.434 | 0.069 | 0.675 | 3e-10 | |
| 312385457 | 613 | hypothetical protein AND_00762 [Anophele | 0.456 | 0.068 | 0.690 | 3e-10 | |
| 260268377 | 575 | alpha-glucosidase [Bombus diversus diver | 0.434 | 0.069 | 0.675 | 4e-10 | |
| 340714803 | 552 | PREDICTED: alpha-glucosidase-like [Bombu | 0.434 | 0.072 | 0.675 | 5e-10 | |
| 159792926 | 588 | alpha-glucosidase binding-toxin receptor | 0.434 | 0.068 | 0.575 | 7e-10 | |
| 170055688 | 605 | alpha-glucosidase [Culex quinquefasciatu | 0.489 | 0.074 | 0.6 | 8e-10 | |
| 193709215 | 621 | PREDICTED: probable maltase H [Acyrthosi | 0.434 | 0.064 | 0.675 | 1e-09 | |
| 307204059 | 573 | Maltase 1 [Harpegnathos saltator] | 0.456 | 0.073 | 0.642 | 1e-09 | |
| 195433767 | 565 | GK15164 [Drosophila willistoni] gi|19416 | 0.434 | 0.070 | 0.6 | 3e-09 |
| >gi|350415025|ref|XP_003490508.1| PREDICTED: alpha-glucosidase-like isoform 1 [Bombus impatiens] gi|350415027|ref|XP_003490509.1| PREDICTED: alpha-glucosidase-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 69.3 bits (168), Expect = 3e-10, Method: Composition-based stats.
Identities = 27/40 (67%), Positives = 33/40 (82%)
Query: 11 GIKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGK 50
GIK+LLD+VPNHTSD+H+WF KS GI PY +YY+W GK
Sbjct: 117 GIKVLLDFVPNHTSDQHEWFQKSLKGIKPYSDYYIWHPGK 156
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|260268379|dbj|BAI44030.1| alpha-glucosidase [Bombus ignitus] | Back alignment and taxonomy information |
|---|
| >gi|312385457|gb|EFR29952.1| hypothetical protein AND_00762 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|260268377|dbj|BAI44029.1| alpha-glucosidase [Bombus diversus diversus] | Back alignment and taxonomy information |
|---|
| >gi|340714803|ref|XP_003395913.1| PREDICTED: alpha-glucosidase-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|159792926|gb|ABW98683.1| alpha-glucosidase binding-toxin receptor [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|170055688|ref|XP_001863693.1| alpha-glucosidase [Culex quinquefasciatus] gi|167875568|gb|EDS38951.1| alpha-glucosidase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|193709215|ref|XP_001943317.1| PREDICTED: probable maltase H [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|307204059|gb|EFN82958.1| Maltase 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|195433767|ref|XP_002064879.1| GK15164 [Drosophila willistoni] gi|194160964|gb|EDW75865.1| GK15164 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 92 | ||||||
| FB|FBgn0002571 | 574 | Mal-A3 "Maltase A3" [Drosophil | 0.445 | 0.071 | 0.634 | 3.6e-09 | |
| FB|FBgn0032382 | 583 | Mal-B2 "Maltase B2" [Drosophil | 0.423 | 0.066 | 0.564 | 6e-09 | |
| FB|FBgn0033294 | 579 | Mal-A4 "Maltase A4" [Drosophil | 0.423 | 0.067 | 0.589 | 9.8e-09 | |
| FB|FBgn0033297 | 588 | Mal-A8 "Maltase A8" [Drosophil | 0.423 | 0.066 | 0.538 | 2.8e-08 | |
| FB|FBgn0002569 | 567 | Mal-A2 "Maltase A2" [Drosophil | 0.434 | 0.070 | 0.575 | 3.3e-08 | |
| UNIPROTKB|F1S5K1 | 251 | F1S5K1 "Uncharacterized protei | 0.489 | 0.179 | 0.416 | 3.6e-08 | |
| FB|FBgn0032381 | 584 | Mal-B1 "Maltase B1" [Drosophil | 0.423 | 0.066 | 0.512 | 4.4e-08 | |
| ZFIN|ZDB-GENE-090313-225 | 674 | slc3a1 "solute carrier family | 0.391 | 0.053 | 0.527 | 8.8e-08 | |
| FB|FBgn0002570 | 577 | Mal-A1 "Maltase A1" [Drosophil | 0.434 | 0.069 | 0.525 | 1.2e-07 | |
| FB|FBgn0033296 | 599 | Mal-A7 "Maltase A7" [Drosophil | 0.423 | 0.065 | 0.538 | 1.2e-07 |
| FB|FBgn0002571 Mal-A3 "Maltase A3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 145 (56.1 bits), Expect = 3.6e-09, P = 3.6e-09
Identities = 26/41 (63%), Positives = 31/41 (75%)
Query: 12 IKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGKGV 52
IKI+LD+VPNHTSDE DWF +S AG Y ++YVW GK V
Sbjct: 111 IKIILDFVPNHTSDECDWFIRSAAGEEEYKDFYVWHTGKVV 151
|
|
| FB|FBgn0032382 Mal-B2 "Maltase B2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033294 Mal-A4 "Maltase A4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033297 Mal-A8 "Maltase A8" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002569 Mal-A2 "Maltase A2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S5K1 F1S5K1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0032381 Mal-B1 "Maltase B1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-090313-225 slc3a1 "solute carrier family 3, member 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0002570 Mal-A1 "Maltase A1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0033296 Mal-A7 "Maltase A7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| cd11328 | 470 | cd11328, AmyAc_maltase, Alpha amylase catalytic do | 8e-20 | |
| cd11359 | 456 | cd11359, AmyAc_SLC3A1, Alpha amylase catalytic dom | 2e-15 | |
| cd11333 | 428 | cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase ca | 2e-14 | |
| cd11331 | 450 | cd11331, AmyAc_OligoGlu_like, Alpha amylase cataly | 6e-13 | |
| cd11316 | 403 | cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic | 1e-12 | |
| TIGR02403 | 543 | TIGR02403, trehalose_treC, alpha,alpha-phosphotreh | 3e-12 | |
| cd11348 | 429 | cd11348, AmyAc_2, Alpha amylase catalytic domain f | 7e-12 | |
| pfam00128 | 314 | pfam00128, Alpha-amylase, Alpha amylase, catalytic | 1e-10 | |
| cd11334 | 447 | cd11334, AmyAc_TreS, Alpha amylase catalytic domai | 2e-10 | |
| PRK10933 | 551 | PRK10933, PRK10933, trehalose-6-phosphate hydrolas | 4e-10 | |
| cd11329 | 477 | cd11329, AmyAc_maltase-like, Alpha amylase catalyt | 4e-10 | |
| cd11330 | 472 | cd11330, AmyAc_OligoGlu, Alpha amylase catalytic d | 5e-10 | |
| cd11324 | 536 | cd11324, AmyAc_Amylosucrase, Alpha amylase catalyt | 2e-09 | |
| TIGR02456 | 539 | TIGR02456, treS_nterm, trehalose synthase | 3e-09 | |
| cd11332 | 481 | cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalyti | 4e-09 | |
| COG0366 | 505 | COG0366, AmyA, Glycosidases [Carbohydrate transpor | 6e-07 | |
| PRK10785 | 598 | PRK10785, PRK10785, maltodextrin glucosidase; Prov | 4e-06 | |
| cd11313 | 336 | cd11313, AmyAc_arch_bac_AmyA, Alpha amylase cataly | 2e-05 | |
| cd11338 | 389 | cd11338, AmyAc_CMD, Alpha amylase catalytic domain | 1e-04 | |
| cd11356 | 458 | cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha | 2e-04 | |
| cd11343 | 445 | cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha a | 8e-04 | |
| cd11340 | 407 | cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catal | 0.003 | |
| cd11320 | 389 | cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase | 0.004 | |
| cd11347 | 391 | cd11347, AmyAc_1, Alpha amylase catalytic domain f | 0.004 |
| >gnl|CDD|200467 cd11328, AmyAc_maltase, Alpha amylase catalytic domain found in maltase (also known as alpha glucosidase) and related proteins | Back alignment and domain information |
|---|
Score = 81.5 bits (202), Expect = 8e-20
Identities = 24/42 (57%), Positives = 32/42 (76%)
Query: 11 GIKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGKGV 52
G+K++LD+VPNH+SDEH+WF KS PY +YYVW +GK
Sbjct: 91 GLKVILDFVPNHSSDEHEWFQKSVKRDEPYKDYYVWHDGKNN 132
|
Maltase (EC 3.2.1.20) hydrolyzes the terminal, non-reducing (1->4)-linked alpha-D-glucose residues in maltose, releasing alpha-D-glucose. In most cases, maltase is equivalent to alpha-glucosidase, but the term "maltase" emphasizes the disaccharide nature of the substrate from which glucose is cleaved, and the term "alpha-glucosidase" emphasizes the bond, whether the substrate is a disaccharide or polysaccharide. The Alpha-amylase family comprises the largest family of glycoside hydrolases (GH), with the majority of enzymes acting on starch, glycogen, and related oligo- and polysaccharides. These proteins catalyze the transformation of alpha-1,4 and alpha-1,6 glucosidic linkages with retention of the anomeric center. The protein is described as having 3 domains: A, B, C. A is a (beta/alpha) 8-barrel; B is a loop between the beta 3 strand and alpha 3 helix of A; C is the C-terminal extension characterized by a Greek key. The majority of the enzymes have an active site cleft found between domains A and B where a triad of catalytic residues (Asp, Glu and Asp) performs catalysis. Other members of this family have lost the catalytic activity as in the case of the human 4F2hc, or only have 2 residues that serve as the catalytic nucleophile and the acid/base, such as Thermus A4 beta-galactosidase with 2 Glu residues (GH42) and human alpha-galactosidase with 2 Asp residues (GH31). The family members are quite extensive and include: alpha amylase, maltosyltransferase, cyclodextrin glycotransferase, maltogenic amylase, neopullulanase, isoamylase, 1,4-alpha-D-glucan maltotetrahydrolase, 4-alpha-glucotransferase, oligo-1,6-glucosidase, amylosucrase, sucrose phosphorylase, and amylomaltase. Length = 470 |
| >gnl|CDD|200494 cd11359, AmyAc_SLC3A1, Alpha amylase catalytic domain found in Solute Carrier family 3 member 1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200472 cd11333, AmyAc_SI_OligoGlu_DGase, Alpha amylase catalytic domain found in Sucrose isomerases, oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), dextran glucosidase (also called glucan 1,6-alpha-glucosidase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200470 cd11331, AmyAc_OligoGlu_like, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200455 cd11316, AmyAc_bac2_AmyA, Alpha amylase catalytic domain found in bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|233851 TIGR02403, trehalose_treC, alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >gnl|CDD|200486 cd11348, AmyAc_2, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
| >gnl|CDD|215737 pfam00128, Alpha-amylase, Alpha amylase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|200473 cd11334, AmyAc_TreS, Alpha amylase catalytic domain found in Trehalose synthetase | Back alignment and domain information |
|---|
| >gnl|CDD|182849 PRK10933, PRK10933, trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200468 cd11329, AmyAc_maltase-like, Alpha amylase catalytic domain family found in maltase | Back alignment and domain information |
|---|
| >gnl|CDD|200469 cd11330, AmyAc_OligoGlu, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase) and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200463 cd11324, AmyAc_Amylosucrase, Alpha amylase catalytic domain found in Amylosucrase | Back alignment and domain information |
|---|
| >gnl|CDD|233874 TIGR02456, treS_nterm, trehalose synthase | Back alignment and domain information |
|---|
| >gnl|CDD|200471 cd11332, AmyAc_OligoGlu_TS, Alpha amylase catalytic domain found in oligo-1,6-glucosidase (also called isomaltase; sucrase-isomaltase; alpha-limit dextrinase), trehalose synthase (also called maltose alpha-D-glucosyltransferase), and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|223443 COG0366, AmyA, Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|236759 PRK10785, PRK10785, maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200452 cd11313, AmyAc_arch_bac_AmyA, Alpha amylase catalytic domain found in archaeal and bacterial Alpha-amylases (also called 1,4-alpha-D-glucan-4-glucanohydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|200477 cd11338, AmyAc_CMD, Alpha amylase catalytic domain found in cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200493 cd11356, AmyAc_Sucrose_phosphorylase-like_1, Alpha amylase catalytic domain found in sucrose phosphorylase-like proteins (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|200481 cd11343, AmyAc_Sucrose_phosphorylase-like, Alpha amylase catalytic domain found in sucrose phosphorylase (also called sucrose glucosyltransferase, disaccharide glucosyltransferase, and sucrose-phosphate alpha-D glucosyltransferase) | Back alignment and domain information |
|---|
| >gnl|CDD|200479 cd11340, AmyAc_bac_CMD_like_3, Alpha amylase catalytic domain found in bacterial cyclomaltodextrinases and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200459 cd11320, AmyAc_AmyMalt_CGTase_like, Alpha amylase catalytic domain found in maltogenic amylases, cyclodextrin glycosyltransferase, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200485 cd11347, AmyAc_1, Alpha amylase catalytic domain found in an uncharacterized protein family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| PRK10933 | 551 | trehalose-6-phosphate hydrolase; Provisional | 99.82 | |
| TIGR02403 | 543 | trehalose_treC alpha,alpha-phosphotrehalase. Treha | 99.82 | |
| COG0366 | 505 | AmyA Glycosidases [Carbohydrate transport and meta | 99.72 | |
| PRK13840 | 495 | sucrose phosphorylase; Provisional | 99.72 | |
| TIGR02456 | 539 | treS_nterm trehalose synthase. Trehalose synthase | 99.71 | |
| TIGR02455 | 688 | TreS_stutzeri trehalose synthase, Pseudomonas stut | 99.7 | |
| TIGR03852 | 470 | sucrose_gtfA sucrose phosphorylase. In the forward | 99.66 | |
| KOG0471|consensus | 545 | 99.65 | ||
| PF00128 | 316 | Alpha-amylase: Alpha amylase, catalytic domain; In | 99.57 | |
| PRK10785 | 598 | maltodextrin glucosidase; Provisional | 99.44 | |
| TIGR02401 | 825 | trehalose_TreY malto-oligosyltrehalose synthase. T | 99.25 | |
| PRK14511 | 879 | maltooligosyl trehalose synthase; Provisional | 99.19 | |
| PRK14507 | 1693 | putative bifunctional 4-alpha-glucanotransferase/m | 99.18 | |
| COG3280 | 889 | TreY Maltooligosyl trehalose synthase [Carbohydrat | 98.96 | |
| PRK09505 | 683 | malS alpha-amylase; Reviewed | 98.86 | |
| PRK09441 | 479 | cytoplasmic alpha-amylase; Reviewed | 98.79 | |
| smart00642 | 166 | Aamy Alpha-amylase domain. | 98.65 | |
| TIGR02103 | 898 | pullul_strch alpha-1,6-glucosidases, pullulanase-t | 98.55 | |
| PLN02877 | 970 | alpha-amylase/limit dextrinase | 98.54 | |
| PLN00196 | 428 | alpha-amylase; Provisional | 98.53 | |
| TIGR02104 | 605 | pulA_typeI pullulanase, type I. Pullulan is an unu | 98.48 | |
| PRK12313 | 633 | glycogen branching enzyme; Provisional | 98.47 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 98.46 | |
| TIGR01515 | 613 | branching_enzym alpha-1,4-glucan:alpha-1,4-glucan | 98.45 | |
| PRK03705 | 658 | glycogen debranching enzyme; Provisional | 98.45 | |
| TIGR02100 | 688 | glgX_debranch glycogen debranching enzyme GlgX. Th | 98.44 | |
| PRK05402 | 726 | glycogen branching enzyme; Provisional | 98.41 | |
| PRK14510 | 1221 | putative bifunctional 4-alpha-glucanotransferase/g | 98.31 | |
| TIGR02102 | 1111 | pullulan_Gpos pullulanase, extracellular, Gram-pos | 98.29 | |
| TIGR01531 | 1464 | glyc_debranch glycogen debranching enzymye. glycog | 98.26 | |
| PLN02361 | 401 | alpha-amylase | 98.18 | |
| PRK14706 | 639 | glycogen branching enzyme; Provisional | 98.18 | |
| PLN02960 | 897 | alpha-amylase | 98.15 | |
| COG1523 | 697 | PulA Type II secretory pathway, pullulanase PulA a | 98.11 | |
| PLN02447 | 758 | 1,4-alpha-glucan-branching enzyme | 98.09 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 98.09 | |
| PLN02784 | 894 | alpha-amylase | 98.08 | |
| PRK14705 | 1224 | glycogen branching enzyme; Provisional | 98.07 | |
| PLN03244 | 872 | alpha-amylase; Provisional | 97.98 | |
| COG0296 | 628 | GlgB 1,4-alpha-glucan branching enzyme [Carbohydra | 97.8 | |
| PF14701 | 423 | hDGE_amylase: glucanotransferase domain of human g | 97.09 | |
| KOG0470|consensus | 757 | 96.64 | ||
| PF14871 | 132 | GHL6: Hypothetical glycosyl hydrolase 6 | 94.95 | |
| KOG2212|consensus | 504 | 91.35 | ||
| PF00150 | 281 | Cellulase: Cellulase (glycosyl hydrolase family 5) | 89.87 | |
| cd06591 | 319 | GH31_xylosidase_XylS XylS is a glycosyl hydrolase | 89.66 | |
| cd06593 | 308 | GH31_xylosidase_YicI YicI alpha-xylosidase is a gl | 89.1 | |
| cd06594 | 317 | GH31_glucosidase_YihQ YihQ is a bacterial alpha-gl | 88.07 | |
| PF02324 | 809 | Glyco_hydro_70: Glycosyl hydrolase family 70; Inte | 87.49 | |
| cd06599 | 317 | GH31_glycosidase_Aec37 Glycosyl hydrolase family 3 | 87.47 | |
| cd06592 | 303 | GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact | 85.53 | |
| PF07745 | 332 | Glyco_hydro_53: Glycosyl hydrolase family 53; Inte | 84.72 | |
| KOG3625|consensus | 1521 | 84.45 | ||
| PRK10658 | 665 | putative alpha-glucosidase; Provisional | 82.16 |
| >PRK10933 trehalose-6-phosphate hydrolase; Provisional | Back alignment and domain information |
|---|
Probab=99.82 E-value=1.9e-20 Score=150.21 Aligned_cols=87 Identities=25% Similarity=0.494 Sum_probs=73.8
Q ss_pred hhHHHHHHcCCEEEEEeccccCCCCchhHHHHhcCCCCCCCcEEEeCCCCcCCCCccccCcccccccCCcccccccceEE
Q psy15652 2 EEEEEDAVTGIKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGKGVWIPGLLKKSRKFVNKKCSSLVTRLEIWYV 81 (92)
Q Consensus 2 ~Lv~~~h~~gmkvilD~V~NH~s~~h~wf~~a~~~~s~~~d~f~~~~~~~~~~~g~~p~~~~~~~~~~w~~~~~~~q~y~ 81 (92)
+||++||++|||||||+|+||+|.+|+||+++.+++++|+|||+|.+... ...+.++.+++++++|.|++.+++||+
T Consensus 85 ~lv~~~h~~gi~vilD~V~NH~s~~~~wf~~~~~~~~~y~d~y~~~~~~~---~~~~~~~~~~~~~~~w~~~~~~~~~y~ 161 (551)
T PRK10933 85 ELVAQAKSRGIRIILDMVFNHTSTQHAWFREALNKESPYRQFYIWRDGEP---ETPPNNWRSKFGGSAWRWHAESEQYYL 161 (551)
T ss_pred HHHHHHHHCCCEEEEEECCCCccCchhHHHhhcCCCCCCcCceEecCCCC---CCCCCcccccCCCccccccCCCCceEe
Confidence 69999999999999999999999999999999878899999999986432 112234566778899999999999999
Q ss_pred EeeeCCCCCC
Q psy15652 82 AVKCDKDVTF 91 (92)
Q Consensus 82 h~~~~~~~~~ 91 (92)
|.|....+|+
T Consensus 162 ~~f~~~~pdL 171 (551)
T PRK10933 162 HLFAPEQADL 171 (551)
T ss_pred ecccccCCcc
Confidence 9998666664
|
|
| >TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase | Back alignment and domain information |
|---|
| >COG0366 AmyA Glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13840 sucrose phosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR02456 treS_nterm trehalose synthase | Back alignment and domain information |
|---|
| >TIGR02455 TreS_stutzeri trehalose synthase, Pseudomonas stutzeri type | Back alignment and domain information |
|---|
| >TIGR03852 sucrose_gtfA sucrose phosphorylase | Back alignment and domain information |
|---|
| >KOG0471|consensus | Back alignment and domain information |
|---|
| >PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PRK10785 maltodextrin glucosidase; Provisional | Back alignment and domain information |
|---|
| >TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase | Back alignment and domain information |
|---|
| >PRK14511 maltooligosyl trehalose synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional | Back alignment and domain information |
|---|
| >COG3280 TreY Maltooligosyl trehalose synthase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09505 malS alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09441 cytoplasmic alpha-amylase; Reviewed | Back alignment and domain information |
|---|
| >smart00642 Aamy Alpha-amylase domain | Back alignment and domain information |
|---|
| >TIGR02103 pullul_strch alpha-1,6-glucosidases, pullulanase-type | Back alignment and domain information |
|---|
| >PLN02877 alpha-amylase/limit dextrinase | Back alignment and domain information |
|---|
| >PLN00196 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >TIGR02104 pulA_typeI pullulanase, type I | Back alignment and domain information |
|---|
| >PRK12313 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase | Back alignment and domain information |
|---|
| >PRK03705 glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02100 glgX_debranch glycogen debranching enzyme GlgX | Back alignment and domain information |
|---|
| >PRK05402 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional | Back alignment and domain information |
|---|
| >TIGR02102 pullulan_Gpos pullulanase, extracellular, Gram-positive | Back alignment and domain information |
|---|
| >TIGR01531 glyc_debranch glycogen debranching enzymye | Back alignment and domain information |
|---|
| >PLN02361 alpha-amylase | Back alignment and domain information |
|---|
| >PRK14706 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02960 alpha-amylase | Back alignment and domain information |
|---|
| >COG1523 PulA Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02447 1,4-alpha-glucan-branching enzyme | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN02784 alpha-amylase | Back alignment and domain information |
|---|
| >PRK14705 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
| >PLN03244 alpha-amylase; Provisional | Back alignment and domain information |
|---|
| >COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF14701 hDGE_amylase: glucanotransferase domain of human glycogen debranching enzyme | Back alignment and domain information |
|---|
| >KOG0470|consensus | Back alignment and domain information |
|---|
| >PF14871 GHL6: Hypothetical glycosyl hydrolase 6 | Back alignment and domain information |
|---|
| >KOG2212|consensus | Back alignment and domain information |
|---|
| >PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd06591 GH31_xylosidase_XylS XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate | Back alignment and domain information |
|---|
| >cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose | Back alignment and domain information |
|---|
| >cd06594 GH31_glucosidase_YihQ YihQ is a bacterial alpha-glucosidase with a conserved glycosyl hydrolase family 31 (GH31) domain that catalyzes the release of an alpha-glucosyl residue from the non-reducing end of alpha-glucoside substrates such as alpha-glucosyl fluoride | Back alignment and domain information |
|---|
| >PF02324 Glyco_hydro_70: Glycosyl hydrolase family 70; InterPro: IPR003318 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd06599 GH31_glycosidase_Aec37 Glycosyl hydrolase family 31 (GH31) domain of a bacterial protein family represented by Escherichia coli protein Aec37 | Back alignment and domain information |
|---|
| >cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase | Back alignment and domain information |
|---|
| >PF07745 Glyco_hydro_53: Glycosyl hydrolase family 53; InterPro: IPR011683 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >KOG3625|consensus | Back alignment and domain information |
|---|
| >PRK10658 putative alpha-glucosidase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 92 | ||||
| 4gin_A | 584 | Crystal Structure Of The Mutb R284c Mutant From Cry | 4e-07 | ||
| 2pwf_A | 556 | Crystal Structure Of The Mutb D200a Mutant In Compl | 4e-07 | ||
| 2pwe_A | 556 | Crystal Structure Of The Mutb E254q Mutant In Compl | 4e-07 | ||
| 2pwg_A | 556 | Crystal Structure Of The Trehalulose Synthase Mutb | 4e-07 | ||
| 4h2c_A | 557 | Trehalulose Synthase Mutb R284c Mutant Length = 557 | 4e-07 | ||
| 4gi6_A | 557 | Crystal Structure Of The Mutb F164l Mutant In Compl | 4e-07 | ||
| 1zja_A | 557 | Crystal Structure Of The Trehalulose Synthase Mutb | 4e-07 | ||
| 1m53_A | 570 | Crystal Structure Of Isomaltulose Synthase (Pali) F | 1e-06 | ||
| 2ze0_A | 555 | Alpha-glucosidase Gsj Length = 555 | 2e-06 | ||
| 1uok_A | 558 | Crystal Structure Of B. Cereus Oligo-1,6-Glucosidas | 4e-06 | ||
| 4aie_A | 549 | Structure Of Glucan-1,6-Alpha-Glucosidase From Lact | 1e-05 | ||
| 3gbd_A | 558 | Crystal Structure Of The Isomaltulose Synthase Smua | 1e-05 | ||
| 3k8k_A | 669 | Crystal Structure Of Susg Length = 669 | 1e-04 | ||
| 3k8l_A | 669 | Crystal Structure Of Susg-D498n Mutant With Maltohe | 1e-04 | ||
| 2zid_A | 543 | Crystal Structure Of Dextran Glucosidase E236q Comp | 2e-04 | ||
| 2zic_A | 543 | Crystal Structure Of Streptococcus Mutans Dextran G | 2e-04 | ||
| 3czk_A | 644 | Crystal Structure Analysis Of Sucrose Hydrolase(Suh | 2e-04 | ||
| 3cze_A | 644 | Crystal Structure Analysis Of Sucrose Hydrolase (Su | 3e-04 | ||
| 1mvy_A | 628 | Amylosucrase Mutant E328q Co-Crystallized With Malt | 6e-04 | ||
| 3ueq_A | 632 | Crystal Structure Of Amylosucrase From Neisseria Po | 6e-04 | ||
| 4fls_A | 628 | Crystal Structure Of Amylosucrase Inactive Double M | 7e-04 | ||
| 4flr_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 7e-04 | ||
| 4flq_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 7e-04 | ||
| 4flo_A | 628 | Crystal Structure Of Amylosucrase Double Mutant A28 | 7e-04 | ||
| 1jgi_A | 628 | Crystal Structure Of The Active Site Mutant Glu328g | 7e-04 | ||
| 1g5a_A | 628 | Amylosucrase From Neisseria Polysaccharea Length = | 7e-04 |
| >pdb|4GIN|A Chain A, Crystal Structure Of The Mutb R284c Mutant From Crystals Soaked With The Inhibitor Deoxynojirimycin Length = 584 | Back alignment and structure |
|
| >pdb|2PWF|A Chain A, Crystal Structure Of The Mutb D200a Mutant In Complex With Glucose Length = 556 | Back alignment and structure |
| >pdb|2PWE|A Chain A, Crystal Structure Of The Mutb E254q Mutant In Complex With The Substrate Sucrose Length = 556 | Back alignment and structure |
| >pdb|2PWG|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 Complexed To The Inhibitor Castanospermine Length = 556 | Back alignment and structure |
| >pdb|4H2C|A Chain A, Trehalulose Synthase Mutb R284c Mutant Length = 557 | Back alignment and structure |
| >pdb|4GI6|A Chain A, Crystal Structure Of The Mutb F164l Mutant In Complex With Glucose Length = 557 | Back alignment and structure |
| >pdb|1ZJA|A Chain A, Crystal Structure Of The Trehalulose Synthase Mutb From Pseudomonas Mesoacidophila Mx-45 (Triclinic Form) Length = 557 | Back alignment and structure |
| >pdb|1M53|A Chain A, Crystal Structure Of Isomaltulose Synthase (Pali) From Klebsiella Sp. Lx3 Length = 570 | Back alignment and structure |
| >pdb|2ZE0|A Chain A, Alpha-glucosidase Gsj Length = 555 | Back alignment and structure |
| >pdb|1UOK|A Chain A, Crystal Structure Of B. Cereus Oligo-1,6-Glucosidase Length = 558 | Back alignment and structure |
| >pdb|4AIE|A Chain A, Structure Of Glucan-1,6-Alpha-Glucosidase From Lactobacillus Acidophilus Ncfm Length = 549 | Back alignment and structure |
| >pdb|3GBD|A Chain A, Crystal Structure Of The Isomaltulose Synthase Smua From Protaminobacter Rubrum Length = 558 | Back alignment and structure |
| >pdb|3K8K|A Chain A, Crystal Structure Of Susg Length = 669 | Back alignment and structure |
| >pdb|3K8L|A Chain A, Crystal Structure Of Susg-D498n Mutant With Maltoheptaose Length = 669 | Back alignment and structure |
| >pdb|2ZID|A Chain A, Crystal Structure Of Dextran Glucosidase E236q Complex With Isomaltotriose Length = 543 | Back alignment and structure |
| >pdb|2ZIC|A Chain A, Crystal Structure Of Streptococcus Mutans Dextran Glucosidase Length = 543 | Back alignment and structure |
| >pdb|3CZK|A Chain A, Crystal Structure Analysis Of Sucrose Hydrolase(Suh) E322q- Sucrose Complex Length = 644 | Back alignment and structure |
| >pdb|3CZE|A Chain A, Crystal Structure Analysis Of Sucrose Hydrolase (Suh)- Tris Complex Length = 644 | Back alignment and structure |
| >pdb|1MVY|A Chain A, Amylosucrase Mutant E328q Co-Crystallized With Maltoheptaose. Length = 628 | Back alignment and structure |
| >pdb|3UEQ|A Chain A, Crystal Structure Of Amylosucrase From Neisseria Polysaccharea In Complex With Turanose Length = 632 | Back alignment and structure |
| >pdb|4FLS|A Chain A, Crystal Structure Of Amylosucrase Inactive Double Mutant F290k-E328q From Neisseria Polysaccharea In Complex With Sucrose Length = 628 | Back alignment and structure |
| >pdb|4FLR|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290l From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|4FLQ|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290i From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|4FLO|A Chain A, Crystal Structure Of Amylosucrase Double Mutant A289p-F290c From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
| >pdb|1JGI|A Chain A, Crystal Structure Of The Active Site Mutant Glu328gln Of Amylosucrase From Neisseria Polysaccharea In Complex With The Natural Substrate Sucrose Length = 628 | Back alignment and structure |
| >pdb|1G5A|A Chain A, Amylosucrase From Neisseria Polysaccharea Length = 628 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 92 | |||
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 5e-18 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 1e-15 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 2e-15 | |
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 3e-15 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 3e-15 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 3e-15 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 4e-15 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 2e-14 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 5e-14 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 4e-09 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 7e-14 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 2e-13 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 9e-13 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 2e-11 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 2e-09 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 4e-09 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 9e-09 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 1e-08 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 1e-08 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 2e-08 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 4e-08 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 7e-08 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 1e-07 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 3e-07 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 6e-07 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 3e-06 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 3e-06 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 4e-06 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 5e-06 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 7e-06 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 8e-06 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 1e-05 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 2e-05 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 2e-05 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 3e-05 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 3e-05 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 5e-05 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 6e-05 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 6e-05 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 4e-04 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 8e-04 |
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Length = 441 | Back alignment and structure |
|---|
Score = 76.0 bits (188), Expect = 5e-18
Identities = 17/41 (41%), Positives = 23/41 (56%)
Query: 11 GIKILLDYVPNHTSDEHDWFAKSKAGIAPYDEYYVWKEGKG 51
GIK++LD +HT H WF K+ G Y +YYVW +
Sbjct: 83 GIKVVLDLPIHHTGFLHTWFQKALKGDPHYRDYYVWANKET 123
|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Length = 488 | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Length = 589 | Back alignment and structure |
|---|
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Length = 570 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Length = 557 | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Length = 555 | Back alignment and structure |
|---|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Length = 558 | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Length = 644 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Length = 669 | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Length = 543 | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Length = 655 | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Length = 628 | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} Length = 704 | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Length = 720 | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Length = 475 | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* Length = 504 | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Length = 424 | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Length = 696 | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Length = 585 | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Length = 449 | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Length = 488 | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Length = 583 | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Length = 588 | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Length = 637 | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Length = 515 | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Length = 637 | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Length = 601 | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Length = 680 | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Length = 483 | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Length = 599 | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Length = 683 | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Length = 686 | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Length = 686 | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Length = 478 | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Length = 485 | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Length = 695 | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Length = 422 | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Length = 484 | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Length = 405 | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Length = 480 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| 1m53_A | 570 | Isomaltulose synthase; klebsiella SP. LX3, sucrose | 99.85 | |
| 1uok_A | 558 | Oligo-1,6-glucosidase; sugar degradation, hydrolas | 99.85 | |
| 1zja_A | 557 | Trehalulose synthase; sucrose isomerase, alpha-amy | 99.85 | |
| 3aj7_A | 589 | Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro | 99.84 | |
| 2zic_A | 543 | Dextran glucosidase; TIM barrel, (beta/alpha)8-bar | 99.82 | |
| 4aie_A | 549 | Glucan 1,6-alpha-glucosidase; hydrolase, glycoside | 99.81 | |
| 2ze0_A | 555 | Alpha-glucosidase; TIM barrel, glucoside hydrolase | 99.81 | |
| 1wza_A | 488 | Alpha-amylase A; hydrolase, halophilic, thermophil | 99.73 | |
| 3k8k_A | 669 | Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet | 99.72 | |
| 3ucq_A | 655 | Amylosucrase; thermostability, amylose synthesis, | 99.72 | |
| 1lwj_A | 441 | 4-alpha-glucanotransferase; alpha-amylase family, | 99.71 | |
| 1g5a_A | 628 | Amylosucrase; glycosyltransferase, glycoside hydro | 99.7 | |
| 3czg_A | 644 | Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; | 99.7 | |
| 4aee_A | 696 | Alpha amylase, catalytic region; hydrolase, hypert | 99.6 | |
| 4aef_A | 645 | Neopullulanase (alpha-amylase II); hydrolase, ther | 99.55 | |
| 3ttq_A | 1108 | Dextransucrase; (beta/alpha)8 barrel, transferase; | 99.55 | |
| 2wc7_A | 488 | Alpha amylase, catalytic region; CD/PUL-hydrolyzin | 99.52 | |
| 2z1k_A | 475 | (NEO)pullulanase; hydrolase, structural genomics, | 99.51 | |
| 3hje_A | 704 | 704AA long hypothetical glycosyltransferase; treha | 99.5 | |
| 1j0h_A | 588 | Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 | 99.44 | |
| 3klk_A | 1039 | Glucansucrase; native form, open conformation, mul | 99.44 | |
| 1wzl_A | 585 | Alpha-amylase II; pullulan, GH-13, alpha-amylase f | 99.4 | |
| 1ea9_C | 583 | Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A | 99.4 | |
| 1iv8_A | 720 | Maltooligosyl trehalose synthase; beta alpha barre | 99.38 | |
| 3edf_A | 601 | FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c | 99.33 | |
| 1r7a_A | 504 | Sucrose phosphorylase; beta-alpha-barrels, dimer, | 99.32 | |
| 4aio_A | 884 | Limit dextrinase; hydrolase, pullulanase, glycosid | 99.3 | |
| 1ji1_A | 637 | Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 | 99.27 | |
| 3bc9_A | 599 | AMYB, alpha amylase, catalytic region; acarbose, t | 99.23 | |
| 1wpc_A | 485 | Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr | 99.23 | |
| 1ud2_A | 480 | Amylase, alpha-amylase; calcium-free, alkaline, hy | 99.22 | |
| 3aie_A | 844 | Glucosyltransferase-SI; beta-alpha-barrels; HET: M | 99.16 | |
| 1cyg_A | 680 | Cyclodextrin glucanotransferase; glycosyltransfera | 99.15 | |
| 3bmv_A | 683 | Cyclomaltodextrin glucanotransferase; glycosidase, | 99.15 | |
| 1d3c_A | 686 | Cyclodextrin glycosyltransferase; alpha-amylase, p | 99.13 | |
| 4gqr_A | 496 | Pancreatic alpha-amylase; glycosyl hydrolase, diab | 99.13 | |
| 1qho_A | 686 | Alpha-amylase; glycoside hydrolase, starch degrada | 99.12 | |
| 1ua7_A | 422 | Alpha-amylase; beta-alpha-barrels, acarbose, greek | 99.04 | |
| 2dh2_A | 424 | 4F2 cell-surface antigen heavy chain; TIM-barrel, | 99.02 | |
| 1ht6_A | 405 | AMY1, alpha-amylase isozyme 1; barley, beta-alpha- | 99.02 | |
| 3bh4_A | 483 | Alpha-amylase; calcium, carbohydrate metabolism, g | 98.99 | |
| 1gcy_A | 527 | Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b | 98.98 | |
| 1mxg_A | 435 | Alpha amylase; hyperthermostable, family 13 glycos | 98.98 | |
| 3dhu_A | 449 | Alpha-amylase; structural genomics, hydrolase, gly | 98.94 | |
| 2e8y_A | 718 | AMYX protein, pullulanase; multiple domain, beta-a | 98.93 | |
| 1gjw_A | 637 | Maltodextrin glycosyltransferase; alpha-amylase, m | 98.92 | |
| 3zss_A | 695 | Putative glucanohydrolase PEP1A; alpha-glucan bios | 98.88 | |
| 1hvx_A | 515 | Alpha-amylase; hydrolase, glycosyltransferase, the | 98.83 | |
| 2aaa_A | 484 | Alpha-amylase; glycosidase; 2.10A {Aspergillus nig | 98.81 | |
| 1g94_A | 448 | Alpha-amylase; beta-alpha-8-barrel, 3 domain struc | 98.78 | |
| 2wan_A | 921 | Pullulanase; hydrolase, glycoside hydrolase, polys | 98.74 | |
| 1jae_A | 471 | Alpha-amylase; glycosidase, carbohydrate metabolis | 98.71 | |
| 2guy_A | 478 | Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; | 98.68 | |
| 3vgf_A | 558 | Malto-oligosyltrehalose trehalohydrolase; alpha/be | 98.67 | |
| 2wsk_A | 657 | Glycogen debranching enzyme; carbohydrate metaboli | 98.66 | |
| 2bhu_A | 602 | Maltooligosyltrehalose trehalohydrolase; alpha-amy | 98.66 | |
| 3m07_A | 618 | Putative alpha amylase; IDP00968, csgid, structura | 98.59 | |
| 2ya0_A | 714 | Putative alkaline amylopullulanase; hydrolase, gly | 98.58 | |
| 1bf2_A | 750 | Isoamylase; hydrolase, glycosidase, debranching en | 98.56 | |
| 2fhf_A | 1083 | Pullulanase; multiple domain, beta-alpha-barrel, a | 98.55 | |
| 2vr5_A | 718 | Glycogen operon protein GLGX; hydrolase, glycosida | 98.53 | |
| 3aml_A | 755 | OS06G0726400 protein; starch-branching, transferas | 98.53 | |
| 3faw_A | 877 | Reticulocyte binding protein; TIM barrel, beta bar | 98.52 | |
| 1m7x_A | 617 | 1,4-alpha-glucan branching enzyme; alpha/beta barr | 98.49 | |
| 2ya1_A | 1014 | Putative alkaline amylopullulanase; hydrolase, gly | 98.43 | |
| 3k1d_A | 722 | 1,4-alpha-glucan-branching enzyme; mycobacterium t | 98.2 | |
| 1hjs_A | 332 | Beta-1,4-galactanase; 4-galactanases, family 53 gl | 89.71 | |
| 1qnr_A | 344 | Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt | 89.61 | |
| 1ur4_A | 399 | Galactanase; hydrolase, beta-1, glycoside hydrolas | 88.12 | |
| 1fob_A | 334 | Beta-1,4-galactanase; B/A barrel, glycosyl hydrola | 87.7 | |
| 3vup_A | 351 | Beta-1,4-mannanase; TIM barrel, digestive fluid, H | 87.67 | |
| 2yfo_A | 720 | Alpha-galactosidase-sucrose kinase agask; hydrolas | 87.61 | |
| 1ceo_A | 343 | Cellulase CELC; glycosyl hydrolase, family A/5 of | 86.02 | |
| 1bqc_A | 302 | Protein (beta-mannanase); glycosyl hydrolase, fami | 85.16 | |
| 1ece_A | 358 | Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. | 85.1 | |
| 1h1n_A | 305 | Endo type cellulase ENGI; hydrolase, glycosyl hydr | 84.43 | |
| 1tvn_A | 293 | Cellulase, endoglucanase G; glycoside hydrolase, C | 84.05 | |
| 1h4p_A | 408 | Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca | 83.93 | |
| 1vjz_A | 341 | Endoglucanase; TM1752, structural genomics, JCSG, | 83.77 | |
| 3pzg_A | 383 | Mannan endo-1,4-beta-mannosidase. glycosyl hydrol | 83.5 | |
| 3nco_A | 320 | Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 | 83.35 | |
| 1egz_A | 291 | Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL | 83.25 | |
| 3n9k_A | 399 | Glucan 1,3-beta-glucosidase; aromatic entranceway/ | 82.98 | |
| 3aof_A | 317 | Endoglucanase; glycosyl hydrolase family 5, cellul | 82.79 | |
| 2cks_A | 306 | Endoglucanase E-5; carbohydrate metabolism, polysa | 82.7 | |
| 1edg_A | 380 | Endoglucanase A; family A, cellulases, xylanases, | 82.43 | |
| 3mi6_A | 745 | Alpha-galactosidase; NESG, structural genomics, PS | 82.23 | |
| 2whl_A | 294 | Beta-mannanase, baman5; glycoside hydrolase, hydro | 82.22 | |
| 1g01_A | 364 | Endoglucanase; alpha/beta barrel, TIM barrel, hydr | 82.19 | |
| 3qr3_A | 340 | Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A | 81.81 | |
| 3ayr_A | 376 | Endoglucanase; TIM barrel, hydrolase, carbohydrate | 81.14 | |
| 1x7f_A | 385 | Outer surface protein; structural genomics, unknow | 80.9 | |
| 7a3h_A | 303 | Endoglucanase; hydrolase, cellulose degradation, g | 80.78 | |
| 4hty_A | 359 | Cellulase; (alpha/beta)8 barrel, family 5 endogluc | 80.56 | |
| 2osx_A | 481 | Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel | 80.47 | |
| 2jep_A | 395 | Xyloglucanase; family 5, plant cell WALL, hydrolas | 80.47 | |
| 3icg_A | 515 | Endoglucanase D; cellulase, xylanase, carbohydrate | 80.44 | |
| 1rh9_A | 373 | Endo-beta-mannanase; endo-beta-mannase, retaining, | 80.37 |
| >1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
Probab=99.85 E-value=8.8e-22 Score=155.49 Aligned_cols=86 Identities=26% Similarity=0.500 Sum_probs=75.1
Q ss_pred hhHHHHHHcCCEEEEEeccccCCCCchhHHHHhc-CCCCCCCcEEEeCCCCcCCCCcc-ccCcccccccCCcccccccce
Q psy15652 2 EEEEEDAVTGIKILLDYVPNHTSDEHDWFAKSKA-GIAPYDEYYVWKEGKGVWIPGLL-KKSRKFVNKKCSSLVTRLEIW 79 (92)
Q Consensus 2 ~Lv~~~h~~gmkvilD~V~NH~s~~h~wf~~a~~-~~s~~~d~f~~~~~~~~~~~g~~-p~~~~~~~~~~w~~~~~~~q~ 79 (92)
+||++||++||+||||+|+||+|.+|+||++++. ++++|+|||+|.++. +|.+ ..+.+++++++|++++.+++|
T Consensus 97 ~lv~~aH~~Gi~VilD~V~NH~s~~~~wf~~~~~~~~~~y~d~y~~~~~~----~g~~p~~~~~~f~~~~w~~~~~~~~~ 172 (570)
T 1m53_A 97 SLVAEMKKRNMRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGK----DNQPPNNYPSFFGGSAWQKDAKSGQY 172 (570)
T ss_dssp HHHHHHHHTTCEEEEEECCSBCCTTSHHHHHHHHCTTCTTGGGBCEECCS----SSSCSSCCBCTTSSBSEEECTTTCCE
T ss_pred HHHHHHHHCCCEEEEEEeccccccccHHHHHhhcCCCCCCccceeecCCC----CCCCCccccccCCCccccccCCCCcE
Confidence 6999999999999999999999999999999885 689999999998754 2333 346677889999999999999
Q ss_pred EEEeeeCCCCCC
Q psy15652 80 YVAVKCDKDVTF 91 (92)
Q Consensus 80 y~h~~~~~~~~~ 91 (92)
|+|.|...++|+
T Consensus 173 y~~~f~~~~pdL 184 (570)
T 1m53_A 173 YLHYFARQQPDL 184 (570)
T ss_dssp EECSSCTTCCBB
T ss_pred EECcccCcCCcc
Confidence 999998877765
|
| >1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* | Back alignment and structure |
|---|
| >3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* | Back alignment and structure |
|---|
| >2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* | Back alignment and structure |
|---|
| >4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} | Back alignment and structure |
|---|
| >2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} | Back alignment and structure |
|---|
| >1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* | Back alignment and structure |
|---|
| >3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* | Back alignment and structure |
|---|
| >1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* | Back alignment and structure |
|---|
| >1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* | Back alignment and structure |
|---|
| >3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A | Back alignment and structure |
|---|
| >4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} | Back alignment and structure |
|---|
| >4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* | Back alignment and structure |
|---|
| >2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A | Back alignment and structure |
|---|
| >2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hje_A 704AA long hypothetical glycosyltransferase; trehalose biosynthesis, maltooligoside trehalose synthase (M family 13 glycoside hydrolases; 1.90A {Sulfolobus tokodaii str} | Back alignment and structure |
|---|
| >1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* | Back alignment and structure |
|---|
| >3klk_A Glucansucrase; native form, open conformation, multidomain protein, glycosyltransferase, transferase; 1.65A {Lactobacillus reuteri} PDB: 3kll_A* 3hz3_A* 4amc_A | Back alignment and structure |
|---|
| >1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A | Back alignment and structure |
|---|
| >1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A | Back alignment and structure |
|---|
| >1r7a_A Sucrose phosphorylase; beta-alpha-barrels, dimer, glycoside hydrolase, transferase; 1.77A {Bifidobacterium adolescentis} SCOP: b.71.1.1 c.1.8.1 PDB: 2gdv_A* 2gdu_A* | Back alignment and structure |
|---|
| >4aio_A Limit dextrinase; hydrolase, pullulanase, glycoside hydrolase family 13; 1.90A {Hordeum vulgare} PDB: 2x4c_A* 2y4s_A* 2y5e_A* 2x4b_A | Back alignment and structure |
|---|
| >1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A | Back alignment and structure |
|---|
| >3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A | Back alignment and structure |
|---|
| >1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* | Back alignment and structure |
|---|
| >1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A | Back alignment and structure |
|---|
| >3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* | Back alignment and structure |
|---|
| >1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A | Back alignment and structure |
|---|
| >1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... | Back alignment and structure |
|---|
| >4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... | Back alignment and structure |
|---|
| >1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* | Back alignment and structure |
|---|
| >1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A | Back alignment and structure |
|---|
| >2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A | Back alignment and structure |
|---|
| >1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* | Back alignment and structure |
|---|
| >3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A | Back alignment and structure |
|---|
| >1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* | Back alignment and structure |
|---|
| >1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* | Back alignment and structure |
|---|
| >3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* | Back alignment and structure |
|---|
| >1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* | Back alignment and structure |
|---|
| >3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* | Back alignment and structure |
|---|
| >1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* | Back alignment and structure |
|---|
| >2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} | Back alignment and structure |
|---|
| >1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* | Back alignment and structure |
|---|
| >2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A | Back alignment and structure |
|---|
| >3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A | Back alignment and structure |
|---|
| >2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* | Back alignment and structure |
|---|
| >3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* | Back alignment and structure |
|---|
| >1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 | Back alignment and structure |
|---|
| >2fhf_A Pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, complex with maltotetraose, hydrolase; HET: GLC; 1.65A {Klebsiella aerogenes} SCOP: b.1.18.2 b.1.18.2 b.3.1.3 b.71.1.1 c.1.8.1 PDB: 2fh6_A* 2fh8_A* 2fhb_A* 2fhc_A* 2fgz_A* | Back alignment and structure |
|---|
| >2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A | Back alignment and structure |
|---|
| >3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A | Back alignment and structure |
|---|
| >3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* | Back alignment and structure |
|---|
| >1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* | Back alignment and structure |
|---|
| >2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* | Back alignment and structure |
|---|
| >1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* | Back alignment and structure |
|---|
| >1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* | Back alignment and structure |
|---|
| >1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A | Back alignment and structure |
|---|
| >3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} | Back alignment and structure |
|---|
| >2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* | Back alignment and structure |
|---|
| >1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A | Back alignment and structure |
|---|
| >1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* | Back alignment and structure |
|---|
| >1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A | Back alignment and structure |
|---|
| >1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A | Back alignment and structure |
|---|
| >1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* | Back alignment and structure |
|---|
| >1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* | Back alignment and structure |
|---|
| >3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* | Back alignment and structure |
|---|
| >1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A | Back alignment and structure |
|---|
| >3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* | Back alignment and structure |
|---|
| >2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* | Back alignment and structure |
|---|
| >1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
| >3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A | Back alignment and structure |
|---|
| >1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* | Back alignment and structure |
|---|
| >3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* | Back alignment and structure |
|---|
| >1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 | Back alignment and structure |
|---|
| >7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A | Back alignment and structure |
|---|
| >4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* | Back alignment and structure |
|---|
| >2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* | Back alignment and structure |
|---|
| >2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* | Back alignment and structure |
|---|
| >1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 92 | ||||
| d1g5aa2 | 554 | c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysacc | 2e-10 | |
| d1iv8a2 | 653 | c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase | 3e-09 | |
| d2d3na2 | 394 | c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillu | 1e-04 | |
| d1ud2a2 | 390 | c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillu | 4e-04 | |
| d1r7aa2 | 434 | c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobac | 0.001 | |
| d1jaea2 | 378 | c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mea | 0.002 |
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Length = 554 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Amylosucrase species: Neisseria polysaccharea [TaxId: 489]
Score = 53.4 bits (127), Expect = 2e-10
Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
Query: 11 GIKILLDYVPNHTSDEHDWFAKSKAGIAPYDE-YYVWKEGKGVW 53
GI ++D++ NHTS+EH+W + AG +D YY++ + +
Sbjct: 176 GISAVVDFIFNHTSNEHEWAQRCAAGDPLFDNFYYIFPDRRMPD 219
|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Length = 653 | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Length = 394 | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Length = 390 | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Length = 434 | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Length = 378 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 92 | |||
| d1m53a2 | 478 | Isomaltulose synthase PalI {Klebsiella sp., lx3 [T | 99.73 | |
| d1uoka2 | 479 | Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 | 99.69 | |
| d1g5aa2 | 554 | Amylosucrase {Neisseria polysaccharea [TaxId: 489] | 99.62 | |
| d1lwha2 | 391 | 4-alpha-glucanotransferase {Thermotoga maritima [T | 99.59 | |
| d1h3ga3 | 422 | Cyclomaltodextrinase, central domain {Flavobacteri | 99.48 | |
| d1wzaa2 | 409 | Bacterial alpha-amylase {Halothermothrix orenii [T | 99.45 | |
| d1iv8a2 | 653 | Maltooligosyl trehalose synthase {Archaeon Sulfolo | 99.45 | |
| d1ea9c3 | 382 | Maltogenic amylase, central domain {Bacillus sp., | 99.37 | |
| d3bmva4 | 406 | Cyclodextrin glycosyltransferase {Thermoanaerobact | 99.35 | |
| d1ht6a2 | 347 | Plant alpha-amylase {Barley (Hordeum vulgare), AMY | 99.35 | |
| d1wzla3 | 382 | Maltogenic amylase, central domain {Thermoactinomy | 99.33 | |
| d1gjwa2 | 572 | Maltosyltransferase {Thermotoga maritima [TaxId: 2 | 99.32 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 99.31 | |
| d1bf2a3 | 475 | Isoamylase, central domain {Pseudomonas amyloderam | 99.29 | |
| d1j0ha3 | 382 | Neopullulanase, central domain {Bacillus stearothe | 99.28 | |
| d1qhoa4 | 407 | Cyclodextrin glycosyltransferase {Bacillus stearot | 99.24 | |
| d1ud2a2 | 390 | Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta | 99.23 | |
| d1r7aa2 | 434 | Sucrose phosphorylase {Bifidobacterium adolescenti | 99.2 | |
| d1ua7a2 | 344 | Bacterial alpha-amylase {Bacillus subtilis [TaxId: | 99.19 | |
| d1mxga2 | 361 | Bacterial alpha-amylase {Archaeon Pyrococcus woese | 99.17 | |
| d2guya2 | 381 | Fungal alpha-amylases {Aspergillus oryzae, Taka-am | 99.16 | |
| d1hx0a2 | 403 | Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 | 99.14 | |
| d1eh9a3 | 400 | Glycosyltrehalose trehalohydrolase, central domain | 99.12 | |
| d1gcya2 | 357 | G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase | 99.11 | |
| d1jaea2 | 378 | Animal alpha-amylase {Yellow mealworm (Tenebrio mo | 99.07 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 99.05 | |
| d1m7xa3 | 396 | 1,4-alpha-glucan branching enzyme, central domain | 99.03 | |
| d1g94a2 | 354 | Bacterial alpha-amylase {Pseudoalteromonas halopla | 99.02 | |
| d1ji1a3 | 432 | Maltogenic amylase, central domain {Thermoactinomy | 99.01 | |
| d1e43a2 | 393 | Bacterial alpha-amylase {Chimera (Bacillus amyloli | 99.0 | |
| d2aaaa2 | 381 | Fungal alpha-amylases {Aspergillus niger, acid amy | 98.96 | |
| d2d3na2 | 394 | Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: | 98.95 | |
| d1hvxa2 | 393 | Bacterial alpha-amylase {Bacillus stearothermophil | 98.95 | |
| d2fhfa5 | 563 | Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 | 96.66 | |
| d1vjza_ | 325 | Endoglucanase homologue TM1752 {Thermotoga maritim | 90.49 | |
| d2f2ha4 | 338 | Putative glucosidase YicI, domain 2 {Escherichia c | 90.18 | |
| d1x7fa2 | 244 | Outer surface protein, N-terminal domain {Bacillus | 89.91 | |
| d1uuqa_ | 410 | Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | 89.06 | |
| d2c0ha1 | 350 | endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed | 88.19 | |
| d1hjsa_ | 332 | Beta-1,4-galactanase {Thielavia heterothallica, ak | 88.1 | |
| d1ecea_ | 358 | Endocellulase E1 {Acidothermus cellulolyticus [Tax | 87.95 | |
| d1ceoa_ | 340 | Endoglucanase CelC {Clostridium thermocellum [TaxI | 87.62 | |
| d1wkya2 | 297 | Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 | 87.55 | |
| d1g01a_ | 357 | Alkaline cellulase K catalytic domain {Bacillus sp | 87.55 | |
| d1ur4a_ | 387 | Beta-1,4-galactanase {Bacillus licheniformis [TaxI | 86.56 | |
| d2pb1a1 | 394 | Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) | 85.8 | |
| d1h4pa_ | 408 | Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom | 85.74 | |
| d1rh9a1 | 370 | Beta-mannanase {Tomato (Lycopersicon esculentum) [ | 85.65 | |
| d1qnra_ | 344 | Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | 85.11 | |
| d1tvna1 | 293 | Endoglucanase Cel5a {Pseudoalteromonas haloplankti | 84.73 | |
| d1foba_ | 334 | Beta-1,4-galactanase {Fungus (Aspergillus aculeatu | 84.53 | |
| d1edga_ | 380 | Endoglucanase CelA {Clostridium cellulolyticum [Ta | 84.13 | |
| d1bqca_ | 302 | Beta-mannanase {Thermomonospora fusca [TaxId: 2021 | 83.36 | |
| d1zy9a2 | 348 | Alpha-galactosidase GalA catalytic domain {Thermot | 83.3 | |
| d1egza_ | 291 | Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: | 83.01 | |
| d1h1na_ | 305 | Endocellulase EngI {Thermoascus aurantiacus [TaxId | 81.32 | |
| d7a3ha_ | 300 | Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId | 80.42 |
| >d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Amylase, catalytic domain domain: Isomaltulose synthase PalI species: Klebsiella sp., lx3 [TaxId: 576]
Probab=99.73 E-value=2.7e-18 Score=127.36 Aligned_cols=87 Identities=25% Similarity=0.481 Sum_probs=74.9
Q ss_pred hhHHHHHHcCCEEEEEeccccCCCCchhHHHHhc-CCCCCCCcEEEeCCCCcCCCCccccCcccccccCCcccccccceE
Q psy15652 2 EEEEEDAVTGIKILLDYVPNHTSDEHDWFAKSKA-GIAPYDEYYVWKEGKGVWIPGLLKKSRKFVNKKCSSLVTRLEIWY 80 (92)
Q Consensus 2 ~Lv~~~h~~gmkvilD~V~NH~s~~h~wf~~a~~-~~s~~~d~f~~~~~~~~~~~g~~p~~~~~~~~~~w~~~~~~~q~y 80 (92)
+||++||++||+||||+|+||+|.+||||+.+.. +.++|.++|.|.+.... ..+....+++++..|.++....++|
T Consensus 83 ~Lv~~aH~~Gi~VilD~V~NH~~~~~~~f~~~~~~~~~~~~~~~~~~d~~~~---~~~~~~~~~~~~~~~~~~~~~~~~~ 159 (478)
T d1m53a2 83 SLVAEMKKRNMRLMIDVVINHTSDQHPWFIQSKSDKNNPYRDYYFWRDGKDN---QPPNNYPSFFGGSAWQKDAKSGQYY 159 (478)
T ss_dssp HHHHHHHHTTCEEEEEECCSBCCTTSHHHHHHHHCTTCTTGGGBCEECCSSS---SCSSCCBCTTSSBSEEECTTTCCEE
T ss_pred HHHHHHHHCCCEEEeccccccccccCchhhhcccCCCCCccccccccCCCcC---CCCccccccCCCCccccccccCccc
Confidence 7999999999999999999999999999999887 57899999999987653 2223456678889999999999999
Q ss_pred EEeeeCCCCCC
Q psy15652 81 VAVKCDKDVTF 91 (92)
Q Consensus 81 ~h~~~~~~~~~ 91 (92)
++.|...++|+
T Consensus 160 ~~~~~~~~~dl 170 (478)
T d1m53a2 160 LHYFARQQPDL 170 (478)
T ss_dssp ECSSCTTCCBB
T ss_pred ccCcCCCCCcc
Confidence 99998887765
|
| >d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} | Back information, alignment and structure |
|---|
| >d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} | Back information, alignment and structure |
|---|
| >d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} | Back information, alignment and structure |
|---|
| >d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} | Back information, alignment and structure |
|---|
| >d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} | Back information, alignment and structure |
|---|
| >d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} | Back information, alignment and structure |
|---|
| >d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} | Back information, alignment and structure |
|---|
| >d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} | Back information, alignment and structure |
|---|
| >d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} | Back information, alignment and structure |
|---|
| >d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} | Back information, alignment and structure |
|---|
| >d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} | Back information, alignment and structure |
|---|
| >d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} | Back information, alignment and structure |
|---|
| >d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2f2ha4 c.1.8.13 (A:248-585) Putative glucosidase YicI, domain 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} | Back information, alignment and structure |
|---|
| >d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} | Back information, alignment and structure |
|---|
| >d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} | Back information, alignment and structure |
|---|
| >d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} | Back information, alignment and structure |
|---|
| >d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} | Back information, alignment and structure |
|---|
| >d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} | Back information, alignment and structure |
|---|
| >d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} | Back information, alignment and structure |
|---|
| >d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} | Back information, alignment and structure |
|---|
| >d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} | Back information, alignment and structure |
|---|
| >d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} | Back information, alignment and structure |
|---|
| >d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} | Back information, alignment and structure |
|---|
| >d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} | Back information, alignment and structure |
|---|
| >d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} | Back information, alignment and structure |
|---|