Diaphorina citri psyllid: psy15672

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MSRVGNCLDASRAWICYWICHSLSLLDEPLSSADKSCVVNFLSQCQSPNGGFGGGPGQDPHIAATYAAVNCLIILGTPEAYNCINRPKLKQFLQRLKAPDGGFHVHDGGEVDIRGVYCALCVALLTQVYSEDLFNNTREWLTACQTYEGGFSGYPGFEAHGGYTFCGFAALCLLKSEHLCDIKALLRWTTNRQMNFEGGFQGRTNKLVDGCYSFWQGGLFPLIYRSLMKAGDTCLDGHWLFHHRALQEYILICCQHFNGGLLDKPENMVAS
cccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccccccEEECccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccccccccccccccccccEEEHHHHcHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccccc
*SRVGNCLDASRAWICYWICHSLSLLDEPLSSADKSCVVNFLSQCQSPNGGFGGGPGQDPHIAATYAAVNCLIILGTPEAYNCINRPKLKQFLQRLKAPDGGFHVHDGGEVDIRGVYCALCVALLTQVYSEDLFNNTREWLTACQTYEGGFSGYPGFEAHGGYTFCGFAALCLLKSEHLCDIKALLRWTTNRQMNFEGGFQGRTNKLVDGCYSFWQGGLFPLIYRSLMKAGDTCLDGHWLFHHRALQEYILICCQHFNGGLL**P******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRVGNCLDASRAWICYWICHSLSLLDEPLSSADKSCVVNFLSQCQSPNGGFGGGPGQDPHIAATYAAVNCLIILGTPEAYNCINRPKLKQFLQRLKAPDGGFHVHDGGEVDIRGVYCALCVALLTQVYSEDLFNNTREWLTACQTYEGGFSGYPGFEAHGGYTFCGFAALCLLKSEHLCDIKALLRWTTNRQMNFEGGFQGRTNKLVDGCYSFWQGGLFPLIYRSLMKAGDTCLDGHWLFHHRALQEYILICCQHFNGGLLDKPENMVAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein farnesyltransferase subunit beta Catalyzes the transfer of a farnesyl moiety from farnesyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins. The beta subunit is responsible for peptide-binding.confidentP49355
Protein farnesyltransferase subunit beta Catalyzes the transfer of a farnesyl moiety from farnesyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins. The beta subunit is responsible for peptide-binding.confidentQ8K2I1
Protein farnesyltransferase subunit beta Catalyzes the transfer of a farnesyl moiety from farnesyl pyrophosphate to a cysteine at the fourth position from the C-terminus of several proteins. The beta subunit is responsible for peptide-binding.confidentP49356

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0042277 [MF]peptide bindingprobableGO:0033218, GO:0003674, GO:0005488
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0018343 [BP]protein farnesylationprobableGO:0044267, GO:0018342, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0097354, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0018344 [BP]protein geranylgeranylationprobableGO:0044267, GO:0018342, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0097354, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0004663 [MF]Rab geranylgeranyltransferase activityprobableGO:0004659, GO:0003824, GO:0016765, GO:0016740, GO:0003674, GO:0004661, GO:0008318
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0051726 [BP]regulation of cell cycleprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005965 [CC]protein farnesyltransferase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0004660 [MF]protein farnesyltransferase activityprobableGO:0004659, GO:0003824, GO:0016765, GO:0016740, GO:0003674, GO:0008318
GO:0019840 [MF]isoprenoid bindingprobableGO:0003674, GO:0008289, GO:0005488
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.58Protein farnesyltransferase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H6F, chain B
Confidence level:very confident
Coverage over the Query: 1-271
View the alignment between query and template
View the model in PyMOL