Diaphorina citri psyllid: psy15673

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480----

MVNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK

cccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccCEEEEEcccccHHHccHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccccccccccccccEEEcccccHHHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHcccccHHHcccccccccccHHHHHHcEEEccccccccccccccccccccHHHHHHHHccccccHHHcccccccccHHHHHHHHcccccccccEECccccEEEcccccccccccEEccccEEEccccccccccccccccccccccccccccccHHHHHHccccccEEEEcccccHHHHHccc

**NFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVNFGDLVQNARDTFDSGKSKPYEFRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Aldehyde dehydrogenase, dimeric NADP-preferring	ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. This protein preferentially oxidizes aromatic aldehyde substrates. It may play a role in the oxidation of toxic aldehydes.	confident	P30838
Aldehyde dehydrogenase, dimeric NADP-preferring	ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. This protein preferentially oxidizes aromatic aldehyde substrates. It may play a role in the oxidation of toxic aldehydes.	confident	A3RF36
Aldehyde dehydrogenase, dimeric NADP-preferring	ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. This protein preferentially oxidizes aromatic aldehyde substrates. It may play a role in the oxidation of toxic aldehydes.	confident	P11883

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0016620 [MF]	oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor	probable	GO:0003824, GO:0016903, GO:0003674, GO:0016491
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031090 [CC]	organelle membrane	probable	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042221 [BP]	response to chemical stimulus	probable	GO:0050896, GO:0008150
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006950 [BP]	response to stress	probable	GO:0050896, GO:0008150
GO:0006081 [BP]	cellular aldehyde metabolic process	probable	GO:0044710, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152
GO:0031967 [CC]	organelle envelope	probable	GO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SZA, chain A
Confidence level:very confident
Coverage over the Query: 2-272,372-475
View the alignment between query and template
View the model in PyMOL

Template: 3LNS, chain A
Confidence level:very confident
Coverage over the Query: 303-367
View the alignment between query and template
View the model in PyMOL

Template: 1AD3, chain A
Confidence level:confident
Coverage over the Query: 3-367,379-404,420-471
View the alignment between query and template
View the model in PyMOL