Psyllid ID: psy15673


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480----
MVNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK
cccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccEEEEEEccccHHHHccHHHHHHHHHHccEEEEccccccHHHHHHHHHHHHcccccccEEEEEccHHHHHHHHHccccEEEEcccccHHHHHHHHHHcccccccccccccccEEEcccccHHHHHHHHHHHHHHccccccccccEEEEcccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccHHHcccccccccccHHHHHHcEEEccccccccccccccccccccHHHHHHHHccccccHHHcccccccccHHHHHHHHHccccccccEEEccccEEEcccccccccccEEccccEEEccccccccccccccccccccccccccccccHHHHHHccccccEEEEcccccHHHHHccc
ccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEccEEEEEcccccHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccEEEEEcccccEEEEcccccHHHHHHHHHHHHcHHHHcccccccEEEEEHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccccEEEEcccccccEEEHHHccccccccccccccccHEEHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHccEEEEcccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcEEEEEEEEcccccccHHHccc
MVNFGDLVQNArdtfdsgkskpyEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKqwmtpekpgkdianmldgvyiypdpygvCLIIgawnyplqlsllpaagaiaagNVVILKPSEVAPASAKIMAELLpkyldndtfQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHltpvtlelggksplyidsSVNIELAVRRFLWGKCinagqtciapdyilCSRQVQAQILNQAKAVLDswyteqeilprqglayhgkysfntfthrksclvkdynpvlealsaplyidssVNIELAVRRFLWGKCinagqtciapdyilCSRQVQAQILNQAKAVLDSWYTEQvqgskhycrivsdKHFQRLKSLVhssgtialggdmdasdrplyidsSVNIELAVRRFLWGkcinagqltrgpgwdrleyhgkysfVTFTHrksclvkdynPVLEALSAFK
mvnfgdlvqnardtfdsgkskpyeFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTlelggksplYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCinagqltrgpgwdrlEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK
MVNFGDLVQNARDTFDSGKSKPYEFrrrqlqqlvrlYEEnqqdlanalaadlRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPaagaiaagnvviLKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK
*****************************LQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEA*****
**NFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK
MVNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK
*VNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPV*E*****K
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVNFGDLVQNARDTFDSGKSKPYEFRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAVLFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPLYIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVKDYNPVLEALSAFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query484 2.2.26 [Sep-21-2011]
A3RF36453 Aldehyde dehydrogenase, d yes N/A 0.882 0.942 0.357 4e-79
P47739453 Aldehyde dehydrogenase, d yes N/A 0.871 0.931 0.358 1e-78
P30838453 Aldehyde dehydrogenase, d yes N/A 0.871 0.931 0.358 2e-78
P11883453 Aldehyde dehydrogenase, d yes N/A 0.880 0.940 0.369 5e-78
Q60HH8485 Fatty aldehyde dehydrogen N/A N/A 0.541 0.540 0.528 2e-77
P51648485 Fatty aldehyde dehydrogen no N/A 0.541 0.540 0.524 5e-77
Q5RF60485 Fatty aldehyde dehydrogen no N/A 0.541 0.540 0.520 2e-76
Q1JPA0468 Aldehyde dehydrogenase fa no N/A 0.431 0.446 0.489 2e-75
Q5XI42468 Aldehyde dehydrogenase fa no N/A 0.551 0.570 0.481 8e-74
P43353468 Aldehyde dehydrogenase fa no N/A 0.421 0.435 0.478 1e-73
>sp|A3RF36|AL3A1_CANFA Aldehyde dehydrogenase, dimeric NADP-preferring OS=Canis familiaris GN=ALDH3A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  295 bits (756), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 170/475 (35%), Positives = 263/475 (55%), Gaps = 48/475 (10%)

Query: 1   MVNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAV 60
           M    ++VQ AR  F+SGK++P +FR +QL+ L R+ +E+++DLA AL ADL K++  A 
Sbjct: 1   MSKISEVVQRARAAFNSGKTRPLQFRIQQLEALRRMIKEHEKDLAGALTADLHKNEWNAY 60

Query: 61  LFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQL 120
             E+ ++  ++   +  L +W   E   K      D  YI+ +P GV LIIG WNYP  +
Sbjct: 61  YEEVVYVLEEIEYMIKKLPEWAADEPVEKTPQTQQDECYIHSEPLGVVLIIGTWNYPFTV 120

Query: 121 SLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHR 180
           ++ P  GAIAAGN V++KPSE++   A ++A ++P+YLD D + V+ GG+ ETTELLK R
Sbjct: 121 TIQPMVGAIAAGNAVVIKPSELSENMANLLATIIPQYLDRDLYPVISGGIPETTELLKER 180

Query: 181 FDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINA 240
           FD+I YTG+T+VGK++  AA +HLTPVTLELGGK+P Y+D   ++++A RR  WGK +N+
Sbjct: 181 FDHILYTGNTAVGKVIMMAAAKHLTPVTLELGGKNPCYVDKDCDLDIACRRIAWGKFMNS 240

Query: 241 GQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSC 300
           GQTC+APDYILC   +Q QI+ + K  L  +Y E     R     +G+   +    R   
Sbjct: 241 GQTCVAPDYILCDPSIQNQIVEKLKKALKEFYGEDAKKSRD----YGRIINSRHFQRVMG 296

Query: 301 LVKDYNPVLEAL--SAPLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQA- 357
           L++           +A  YI  ++ I++  +  +  + I      + P  I+C R ++  
Sbjct: 297 LMEGQKVAYGGTGDAATRYIAPTILIDVDTQSQVMQEEIFGP---VMP--IVCVRSLEEA 351

Query: 358 -QILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPL 416
            Q +NQ +  L             Y   ++DK  +++ +   S G  A            
Sbjct: 352 IQFINQREKPL-----------ALYVFSLNDKMIKKMIAETSSGGVTA------------ 388

Query: 417 YIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVK 471
              + V + ++V    +G   N+G  +         YHGK SF TF+H +SCLV+
Sbjct: 389 ---NDVIVHVSVHSLPYGGVGNSGMGS---------YHGKKSFETFSHCRSCLVR 431




ALDHs play a major role in the detoxification of alcohol-derived acetaldehyde. They are involved in the metabolism of corticosteroids, biogenic amines, neurotransmitters, and lipid peroxidation. This protein preferentially oxidizes aromatic aldehyde substrates. It may play a role in the oxidation of toxic aldehydes.
Canis familiaris (taxid: 9615)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 5
>sp|P47739|AL3A1_MOUSE Aldehyde dehydrogenase, dimeric NADP-preferring OS=Mus musculus GN=Aldh3a1 PE=2 SV=2 Back     alignment and function description
>sp|P30838|AL3A1_HUMAN Aldehyde dehydrogenase, dimeric NADP-preferring OS=Homo sapiens GN=ALDH3A1 PE=1 SV=3 Back     alignment and function description
>sp|P11883|AL3A1_RAT Aldehyde dehydrogenase, dimeric NADP-preferring OS=Rattus norvegicus GN=Aldh3a1 PE=1 SV=3 Back     alignment and function description
>sp|Q60HH8|AL3A2_MACFA Fatty aldehyde dehydrogenase OS=Macaca fascicularis GN=ALDH3A2 PE=2 SV=1 Back     alignment and function description
>sp|P51648|AL3A2_HUMAN Fatty aldehyde dehydrogenase OS=Homo sapiens GN=ALDH3A2 PE=1 SV=1 Back     alignment and function description
>sp|Q5RF60|AL3A2_PONAB Fatty aldehyde dehydrogenase OS=Pongo abelii GN=ALDH3A2 PE=2 SV=1 Back     alignment and function description
>sp|Q1JPA0|AL3B1_BOVIN Aldehyde dehydrogenase family 3 member B1 OS=Bos taurus GN=ALDH3B1 PE=2 SV=1 Back     alignment and function description
>sp|Q5XI42|AL3B1_RAT Aldehyde dehydrogenase family 3 member B1 OS=Rattus norvegicus GN=Aldh3b1 PE=2 SV=1 Back     alignment and function description
>sp|P43353|AL3B1_HUMAN Aldehyde dehydrogenase family 3 member B1 OS=Homo sapiens GN=ALDH3B1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
328722598 587 PREDICTED: aldehyde dehydrogenase, dimer 0.561 0.463 0.649 1e-106
193683363502 PREDICTED: aldehyde dehydrogenase, dimer 0.561 0.541 0.649 1e-106
328722601503 PREDICTED: aldehyde dehydrogenase, dimer 0.440 0.423 0.649 1e-106
158292610495 AGAP005124-PC [Anopheles gambiae str. PE 0.553 0.541 0.656 1e-105
158292608494 AGAP005124-PB [Anopheles gambiae str. PE 0.553 0.542 0.656 1e-105
158292606494 AGAP005124-PA [Anopheles gambiae str. PE 0.553 0.542 0.656 1e-105
170032167521 conserved hypothetical protein [Culex qu 0.433 0.403 0.616 1e-101
198459521 608 GA24936 [Drosophila pseudoobscura pseudo 0.944 0.751 0.420 1e-100
350419912 597 PREDICTED: fatty aldehyde dehydrogenase- 0.962 0.780 0.403 7e-97
307188352534 Fatty aldehyde dehydrogenase [Camponotus 0.942 0.853 0.429 1e-96
>gi|328722598|ref|XP_003247611.1| PREDICTED: aldehyde dehydrogenase, dimeric NADP-preferring-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  392 bits (1007), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 178/274 (64%), Positives = 223/274 (81%)

Query: 1   MVNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAV 60
           M N+ D+V+ A+  F+S ++K    R+  L+QL++L  EN  DL  ALA+DLRK KQEAV
Sbjct: 88  MANYADIVEKAKSAFNSNQTKSLHLRKHHLRQLLKLLNENSSDLQIALASDLRKSKQEAV 147

Query: 61  LFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQL 120
           LFEIE+L ND+ N L  L+ WM  E+P K + N++D V I+ DPYGV L++GAWNYPLQL
Sbjct: 148 LFEIEYLKNDIINALGSLESWMKTERPDKPLINIMDDVLIHKDPYGVVLVMGAWNYPLQL 207

Query: 121 SLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHR 180
           +LLP  GAIAAGN VI+KPSE+APA+AK++AEL+PKYL+ D F V+LGGVEETT LLK R
Sbjct: 208 TLLPVVGAIAAGNSVIIKPSEIAPATAKLIAELIPKYLNRDAFPVILGGVEETTLLLKQR 267

Query: 181 FDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINA 240
           FDYIFYTGSTSVGKIVR AANE+LTPVTLELGGKSPLYID +VN+++AV+R +WGKCINA
Sbjct: 268 FDYIFYTGSTSVGKIVRAAANEYLTPVTLELGGKSPLYIDGTVNMDIAVKRIIWGKCINA 327

Query: 241 GQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTE 274
           GQTCIAPDY+LC+RQVQ   + +AK +L +WYT+
Sbjct: 328 GQTCIAPDYVLCTRQVQNSFVEKAKQLLKAWYTD 361




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193683363|ref|XP_001950992.1| PREDICTED: aldehyde dehydrogenase, dimeric NADP-preferring-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328722601|ref|XP_003247612.1| PREDICTED: aldehyde dehydrogenase, dimeric NADP-preferring-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158292610|ref|XP_314005.4| AGAP005124-PC [Anopheles gambiae str. PEST] gi|157017072|gb|EAA09458.5| AGAP005124-PC [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158292608|ref|XP_001688504.1| AGAP005124-PB [Anopheles gambiae str. PEST] gi|157017071|gb|EDO64087.1| AGAP005124-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|158292606|ref|XP_001688503.1| AGAP005124-PA [Anopheles gambiae str. PEST] gi|157017070|gb|EDO64086.1| AGAP005124-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170032167|ref|XP_001843954.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167871903|gb|EDS35286.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|198459521|ref|XP_002138699.1| GA24936 [Drosophila pseudoobscura pseudoobscura] gi|198136719|gb|EDY69257.1| GA24936 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|350419912|ref|XP_003492342.1| PREDICTED: fatty aldehyde dehydrogenase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307188352|gb|EFN73127.1| Fatty aldehyde dehydrogenase [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query484
FB|FBgn0010548563 Aldh-III "Aldehyde dehydrogena 0.566 0.486 0.529 3.1e-85
UNIPROTKB|D4A137507 Aldh3a2 "Aldehyde dehydrogenas 0.551 0.526 0.449 9.8e-68
UNIPROTKB|E2RPP8599 ALDH3A2 "Uncharacterized prote 0.551 0.445 0.441 5.4e-67
RGD|61866484 Aldh3a2 "aldehyde dehydrogenas 0.551 0.551 0.449 1.8e-66
UNIPROTKB|P30839484 Aldh3a2 "Fatty aldehyde dehydr 0.551 0.551 0.449 1.8e-66
MGI|MGI:1353451453 Aldh3a1 "aldehyde dehydrogenas 0.566 0.604 0.419 6.1e-66
UNIPROTKB|P51648485 ALDH3A2 "Fatty aldehyde dehydr 0.551 0.550 0.449 9.8e-66
UNIPROTKB|F1NH33490 ALDH3A2 "Aldehyde dehydrogenas 0.566 0.559 0.419 2e-65
UNIPROTKB|A6QQT4485 ALDH3A2 "Aldehyde dehydrogenas 0.551 0.550 0.441 2.6e-65
UNIPROTKB|Q1JPA0468 ALDH3B1 "Aldehyde dehydrogenas 0.611 0.632 0.399 6.8e-65
FB|FBgn0010548 Aldh-III "Aldehyde dehydrogenase type III" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 756 (271.2 bits), Expect = 3.1e-85, Sum P(2) = 3.1e-85
 Identities = 145/274 (52%), Positives = 179/274 (65%)

Query:     1 MVNFGDLVQNARDTFDSGKSKPYEFXXXXXXXXXXXYEEXXXXXXXXXXXXXRKHKQEAV 60
             M NF D +Q AR  F SGK++   F           YEE             R+ KQE++
Sbjct:    66 MANFDDTLQRARLAFSSGKTRNVSFRRKQLENLLRCYEEHENEIISALEADLRRPKQESL 125

Query:    61 LFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQL 120
             + E EF+ ND+R+ L  L +W+  EKP K   NM+D V IY DP+GV L+IGAWNYPLQL
Sbjct:   126 IVETEFMKNDIRHILFQLDEWVQSEKPPKSFVNMMDDVQIYNDPFGVVLVIGAWNYPLQL 185

Query:   121 SLLPXXXXXXXXXXXXLKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHR 180
              L+P            +KPSE+A   AK +A+++PKYLDND + VV GG  ET ELL  R
Sbjct:   186 LLVPVASAIAAGNCVVIKPSEIAANCAKFIADVIPKYLDNDCYPVVCGGPSETAELLNQR 245

Query:   181 FDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINA 240
             FDYIFYTGST VGKI+  AAN++LTP TLELGGKSP YID SV++  AV+R LWGK IN 
Sbjct:   246 FDYIFYTGSTRVGKIIHAAANKYLTPTTLELGGKSPCYIDKSVDMRTAVKRILWGKLINC 305

Query:   241 GQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTE 274
             GQTCIAPDYILCS++VQ + + +AK VL  WY E
Sbjct:   306 GQTCIAPDYILCSKEVQEKFIVEAKDVLKEWYGE 339


GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=ISS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006081 "cellular aldehyde metabolic process" evidence=IEA
GO:0004030 "aldehyde dehydrogenase [NAD(P)+
GO:0005811 "lipid particle" evidence=IDA
UNIPROTKB|D4A137 Aldh3a2 "Aldehyde dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPP8 ALDH3A2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|61866 Aldh3a2 "aldehyde dehydrogenase 3 family, member A2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P30839 Aldh3a2 "Fatty aldehyde dehydrogenase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1353451 Aldh3a1 "aldehyde dehydrogenase family 3, subfamily A1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P51648 ALDH3A2 "Fatty aldehyde dehydrogenase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH33 ALDH3A2 "Aldehyde dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQT4 ALDH3A2 "Aldehyde dehydrogenase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q1JPA0 ALDH3B1 "Aldehyde dehydrogenase family 3 member B1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P47739AL3A1_MOUSE1, ., 2, ., 1, ., 50.35830.87190.9315yesN/A
P30838AL3A1_HUMAN1, ., 2, ., 1, ., 50.35830.87190.9315yesN/A
P11883AL3A1_RAT1, ., 2, ., 1, ., 50.36970.88010.9403yesN/A
A3RF36AL3A1_CANFA1, ., 2, ., 1, ., 50.35780.88220.9426yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.2.10.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 1e-171
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 1e-141
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 1e-122
PTZ00381493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 1e-122
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 1e-120
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 2e-98
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 8e-89
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 1e-86
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 6e-86
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 4e-74
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 1e-73
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 2e-73
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 2e-66
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 2e-56
cd07099453 cd07099, ALDH_DDALDH, Methylomonas sp 9e-46
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 2e-42
cd07138466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 2e-39
cd07109454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 1e-37
cd07089459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 2e-37
cd07104431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 6e-37
cd07114457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 3e-34
cd07150451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 7e-34
cd07098465 cd07098, ALDH_F15-22, Aldehyde dehydrogenase famil 1e-33
cd07106446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 1e-33
cd07093455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 2e-33
cd07090457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 2e-32
cd07119482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 2e-32
cd07100429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 2e-32
cd07103451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 5e-32
cd07149453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 8e-32
cd07091476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 8e-32
TIGR01804467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 8e-32
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 1e-31
cd07102452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 1e-31
cd07108457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 7e-31
cd07559480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 2e-30
cd07092450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 2e-30
cd07110456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 2e-30
cd07105432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 5e-30
cd07088468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 5e-30
cd07131478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 6e-30
cd07144484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 8e-30
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 2e-29
cd07094453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 2e-29
cd07101454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 2e-29
cd07112462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 2e-29
cd07117475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 8e-29
PRK13252488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 2e-28
cd07115453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 2e-28
cd07139471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 5e-28
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 1e-27
PTZ00381 493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 2e-27
cd07151465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 2e-27
cd07095431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 2e-27
PRK13473475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 4e-27
cd07086478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 5e-27
cd07145456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 7e-27
cd07134433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 2e-26
cd07097473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 2e-26
cd07142476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 2e-26
PRK09407524 PRK09407, gabD2, succinic semialdehyde dehydrogena 3e-26
cd07141481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 4e-26
cd07152443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 3e-25
TIGR01780448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 3e-25
PLN02278498 PLN02278, PLN02278, succinic semialdehyde dehydrog 4e-25
PLN02766501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 2e-24
cd07120455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 3e-24
cd07143481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 9e-24
cd07124512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 9e-24
cd07140486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 1e-23
PLN02467503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 2e-23
cd07146451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 2e-23
cd07118454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 3e-23
PRK10090409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 6e-23
cd07107456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 7e-23
cd07085478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 4e-22
cd07147452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 4e-22
TIGR02299488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 6e-22
PLN02466538 PLN02466, PLN02466, aldehyde dehydrogenase family 8e-22
cd07082473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 8e-22
cd07116479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 9e-22
cd07113477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 2e-21
cd07130474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 2e-20
TIGR01237511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 3e-20
PRK09847494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 7e-20
cd07133434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 9e-20
cd07111480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 2e-19
TIGR03240484 TIGR03240, arg_catab_astD, succinylglutamic semial 2e-19
PRK09457487 PRK09457, astD, succinylglutamic semialdehyde dehy 2e-19
cd07125518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 9e-19
PRK03137514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 5e-18
TIGR03216481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 2e-17
TIGR01722477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 2e-17
cd07137432 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase 3e-17
PRK11241482 PRK11241, gabD, succinate-semialdehyde dehydrogena 6e-17
PRK09406457 PRK09406, gabD1, succinic semialdehyde dehydrogena 1e-16
TIGR03250472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 1e-16
cd07084442 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+ 1e-16
TIGR04284480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 3e-16
TIGR03374472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 3e-16
cd07083500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 5e-16
PLN02203484 PLN02203, PLN02203, aldehyde dehydrogenase 6e-14
PLN02315508 PLN02315, PLN02315, aldehyde dehydrogenase family 8e-14
PLN02174484 PLN02174, PLN02174, aldehyde dehydrogenase family 4e-13
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 1e-12
TIGR01238500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 2e-12
cd07078432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 8e-12
cd07148455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 4e-11
PRK13968462 PRK13968, PRK13968, putative succinate semialdehyd 4e-11
PLN02419604 PLN02419, PLN02419, methylmalonate-semialdehyde de 5e-10
PLN00412496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 2e-09
cd06534367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 5e-09
cd07077397 cd07077, ALDH-like, NAD(P)+-dependent aldehyde deh 5e-09
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 6e-09
PRK11809 1318 PRK11809, putA, trifunctional transcriptional regu 1e-08
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 2e-08
cd07132 443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 6e-08
cd07132443 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3e-07
COG1012472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 8e-07
TIGR02518488 TIGR02518, EutH_ACDH, acetaldehyde dehydrogenase ( 2e-06
PTZ00381 493 PTZ00381, PTZ00381, aldehyde dehydrogenase family 3e-06
cd07129454 cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdeh 3e-06
pfam00171459 pfam00171, Aldedh, Aldehyde dehydrogenase family 4e-06
PRK119041038 PRK11904, PRK11904, bifunctional proline dehydroge 4e-06
cd07087 426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 9e-06
TIGR02278 663 TIGR02278, PaaN-DH, phenylacetic acid degradation 2e-05
cd07135 436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 3e-05
TIGR02288551 TIGR02288, PaaN_2, phenylacetic acid degradation p 4e-05
cd07136 449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 1e-04
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 3e-04
cd07134 433 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehy 3e-04
cd07087426 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: 4e-04
TIGR01092715 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate s 6e-04
cd07127549 cd07127, ALDH_PAD-PaaZ, Phenylacetic acid degradat 0.001
cd07136449 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldeh 0.002
cd07133 434 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehyd 0.003
TIGR01236532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 0.003
cd07135436 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisia 0.004
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
 Score =  489 bits (1262), Expect = e-171
 Identities = 166/269 (61%), Positives = 212/269 (78%)

Query: 6   DLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIE 65
           + V+ AR+ F SGK++P EFR +QL+ L+R+ EEN+ ++  ALA DLRK K EAVL EI 
Sbjct: 2   EAVRRAREAFSSGKTRPLEFRIQQLEALLRMLEENEDEIVEALAKDLRKPKFEAVLSEIL 61

Query: 66  FLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPA 125
            + N+++  +++L +WM PE   K++A +LD VYIY +P GV LIIGAWNYPLQL+L+P 
Sbjct: 62  LVKNEIKYAISNLPEWMKPEPVKKNLATLLDDVYIYKEPLGVVLIIGAWNYPLQLTLVPL 121

Query: 126 AGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRFDYIF 185
            GAIAAGN V++KPSEV+PA+AK++AEL+PKYLD + + VVLGGVEETTELLK RFDYIF
Sbjct: 122 VGAIAAGNCVVIKPSEVSPATAKLLAELIPKYLDKECYPVVLGGVEETTELLKQRFDYIF 181

Query: 186 YTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCI 245
           YTGSTSVGKIV QAA +HLTPVTLELGGKSP Y+D S +I++A RR  WGK INAGQTCI
Sbjct: 182 YTGSTSVGKIVMQAAAKHLTPVTLELGGKSPCYVDKSCDIDVAARRIAWGKFINAGQTCI 241

Query: 246 APDYILCSRQVQAQILNQAKAVLDSWYTE 274
           APDY+LC+ +VQ + +   K  L  +Y E
Sbjct: 242 APDYVLCTPEVQEKFVEALKKTLKEFYGE 270


NAD(P)+-dependent, aldehyde dehydrogenase, family 3 members A1 and B1 (ALDH3A1, ALDH3B1, EC=1.2.1.5) and fatty aldehyde dehydrogenase, family 3 member A2 (ALDH3A2, EC=1.2.1.3), and similar sequences are included in this CD. Human ALDH3A1 is a homodimer with a critical role in cellular defense against oxidative stress; it catalyzes the oxidation of various cellular membrane lipid-derived aldehydes. Corneal crystalline ALDH3A1 protects the cornea and underlying lens against UV-induced oxidative stress. Human ALDH3A2, a microsomal homodimer, catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acids. Human ALDH3B1 is highly expressed in the kidney and liver and catalyzes the oxidation of various medium- and long-chain saturated and unsaturated aliphatic aldehydes. Length = 443

>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143416 cd07098, ALDH_F15-22, Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143455 cd07137, ALDH_F3FHI, Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|181826 PRK09406, gabD1, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143403 cd07084, ALDH_KGSADH-like, ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|165847 PLN02203, PLN02203, aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|177949 PLN02315, PLN02315, aldehyde dehydrogenase family 7 member Back     alignment and domain information
>gnl|CDD|177831 PLN02174, PLN02174, aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|166060 PLN02419, PLN02419, methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|143396 cd07077, ALDH-like, NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|143450 cd07132, ALDH_F3AB, Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131570 TIGR02518, EutH_ACDH, acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>gnl|CDD|240392 PTZ00381, PTZ00381, aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>gnl|CDD|143447 cd07129, ALDH_KGSADH, Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|131331 TIGR02278, PaaN-DH, phenylacetic acid degradation protein paaN Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>gnl|CDD|131341 TIGR02288, PaaN_2, phenylacetic acid degradation protein paaN Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143452 cd07134, ALDH_AlkH-like, Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>gnl|CDD|143406 cd07087, ALDH_F3-13-14_CALDH-like, ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>gnl|CDD|130164 TIGR01092, P5CS, delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>gnl|CDD|143445 cd07127, ALDH_PAD-PaaZ, Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>gnl|CDD|143454 cd07136, ALDH_YwdH-P39616, Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>gnl|CDD|143451 cd07133, ALDH_CALDH_CalB, Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143453 cd07135, ALDH_F14-YMR110C, Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 484
PLN02174484 aldehyde dehydrogenase family 3 member H1 100.0
KOG2451|consensus503 100.0
KOG2456|consensus477 100.0
KOG2450|consensus501 100.0
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 100.0
PTZ00381493 aldehyde dehydrogenase family protein; Provisional 100.0
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 100.0
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 100.0
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 100.0
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 100.0
PLN02766501 coniferyl-aldehyde dehydrogenase 100.0
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 100.0
PLN02203484 aldehyde dehydrogenase 100.0
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 100.0
PLN02278498 succinic semialdehyde dehydrogenase 100.0
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 100.0
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 100.0
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 100.0
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 100.0
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 100.0
PLN02466538 aldehyde dehydrogenase family 2 member 100.0
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 100.0
PLN02467503 betaine aldehyde dehydrogenase 100.0
PLN02315508 aldehyde dehydrogenase family 7 member 100.0
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 100.0
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 100.0
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 100.0
PRK13252488 betaine aldehyde dehydrogenase; Provisional 100.0
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 100.0
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 100.0
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 100.0
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 100.0
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 100.0
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 100.0
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 100.0
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 100.0
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 100.0
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 100.0
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 100.0
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 100.0
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 100.0
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 100.0
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 100.0
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 100.0
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 100.0
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 100.0
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 100.0
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 100.0
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 100.0
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 100.0
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 100.0
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 100.0
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 100.0
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 100.0
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 100.0
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 100.0
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 100.0
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 100.0
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 100.0
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 100.0
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 100.0
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 100.0
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 100.0
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 100.0
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 100.0
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 100.0
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 100.0
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 100.0
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 100.0
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 100.0
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 100.0
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 100.0
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 100.0
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 100.0
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 100.0
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 100.0
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 100.0
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 100.0
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 100.0
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 100.0
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 100.0
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 100.0
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 100.0
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 100.0
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 100.0
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 100.0
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 100.0
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 100.0
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 100.0
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 100.0
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 100.0
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 100.0
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 100.0
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 100.0
PRK10090409 aldehyde dehydrogenase A; Provisional 100.0
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 100.0
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 100.0
PRK11903521 aldehyde dehydrogenase; Provisional 100.0
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 100.0
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 100.0
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 100.0
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 100.0
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 100.0
PRK11809 1318 putA trifunctional transcriptional regulator/proli 100.0
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 100.0
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 100.0
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 100.0
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 100.0
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 100.0
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 100.0
KOG2454|consensus583 100.0
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 100.0
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 100.0
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 100.0
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 100.0
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 100.0
PRK15398465 aldehyde dehydrogenase EutE; Provisional 100.0
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 100.0
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 100.0
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 100.0
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 100.0
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 100.0
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 100.0
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 100.0
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 100.0
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 100.0
KOG2452|consensus881 100.0
KOG2455|consensus561 100.0
KOG2453|consensus507 100.0
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 100.0
COG0014417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.94
KOG4165|consensus433 99.77
PF05893399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 99.58
KOG2455|consensus561 99.07
PTZ00381 493 aldehyde dehydrogenase family protein; Provisional 98.7
PLN02174484 aldehyde dehydrogenase family 3 member H1 98.63
cd07129454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 98.57
cd07122436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 98.54
cd07101454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 98.49
PRK11241482 gabD succinate-semialdehyde dehydrogenase I; Provi 98.48
TIGR03374472 ABALDH 1-pyrroline dehydrogenase. Members of this 98.48
PRK10090409 aldehyde dehydrogenase A; Provisional 98.46
cd07113477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 98.44
cd07142476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 98.43
PLN02766501 coniferyl-aldehyde dehydrogenase 98.43
cd07099453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 98.43
cd07100429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 98.42
PRK13968462 putative succinate semialdehyde dehydrogenase; Pro 98.42
cd07090457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 98.42
COG1012472 PutA NAD-dependent aldehyde dehydrogenases [Energy 98.42
cd07106446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 98.42
TIGR03216481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 98.42
PRK119051208 bifunctional proline dehydrogenase/pyrroline-5-car 98.42
PRK13473475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 98.41
cd07117475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 98.41
cd07097473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 98.4
cd07086478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 98.39
cd07145456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 98.39
PRK09406457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 98.39
cd07109454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 98.39
cd07125518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 98.39
cd07128513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 98.39
PRK15398465 aldehyde dehydrogenase EutE; Provisional 98.39
TIGR02299488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 98.39
cd07105432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 98.38
PLN02278498 succinic semialdehyde dehydrogenase 98.38
cd07151465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 98.38
cd07115453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 98.38
cd07118454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 98.38
cd07107456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 98.37
cd07130474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 98.37
cd07152443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 98.37
cd07123522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 98.37
cd07143481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 98.37
cd07108457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 98.36
cd07119482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 98.36
cd07133434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 98.36
TIGR01237511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 98.36
cd07091476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 98.36
PLN02315508 aldehyde dehydrogenase family 7 member 98.36
TIGR01238500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 98.35
cd07092450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 98.35
cd07089459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 98.35
PLN02466538 aldehyde dehydrogenase family 2 member 98.35
cd07144484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 98.34
PRK13252488 betaine aldehyde dehydrogenase; Provisional 98.34
cd07132443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 98.34
PLN00412496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 98.34
cd07121429 ALDH_EutE Ethanolamine utilization protein EutE-li 98.34
cd07110456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 98.34
PRK09407524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 98.34
cd07141481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 98.34
TIGR01236533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 98.34
cd07140486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 98.34
cd07139471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 98.33
cd07088468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 98.33
cd07131478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 98.33
TIGR01780448 SSADH succinate-semialdehyde dehydrogenase. SSADH 98.33
cd07124512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 98.33
cd07085478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 98.33
cd07114457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 98.33
cd07111480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 98.32
cd07104431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 98.32
cd07135436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 98.31
cd07150451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 98.31
cd07559480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 98.31
cd07148455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 98.3
PLN02467503 betaine aldehyde dehydrogenase 98.3
cd07103451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 98.3
cd07138466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 98.3
cd07093455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 98.3
cd07079406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 98.3
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 98.3
PRK03137514 1-pyrroline-5-carboxylate dehydrogenase; Provision 98.29
cd07120455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 98.28
cd07136449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 98.28
cd07083500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 98.28
TIGR01804467 BADH glycine betaine aldehyde dehydrogenase. Betai 98.27
TIGR03250472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 98.27
PRK11903521 aldehyde dehydrogenase; Provisional 98.26
PLN02419604 methylmalonate-semialdehyde dehydrogenase [acylati 98.26
cd07137432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 98.26
cd07102452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 98.25
PRK09457487 astD succinylglutamic semialdehyde dehydrogenase; 98.25
cd07094453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 98.24
PRK00197417 proA gamma-glutamyl phosphate reductase; Provision 98.24
cd07147452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 98.23
cd07095431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 98.23
cd07112462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 98.23
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 98.23
cd07134433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 98.22
cd07087426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 98.21
cd07098465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 98.2
cd07146451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 98.2
cd07149453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 98.2
PLN02203484 aldehyde dehydrogenase 98.2
TIGR03240484 arg_catab_astD succinylglutamic semialdehyde dehyd 98.19
cd07081439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 98.18
KOG2451|consensus503 98.18
cd07127549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 98.18
TIGR02288551 PaaN_2 phenylacetic acid degradation protein paaN. 98.17
TIGR00407398 proA gamma-glutamyl phosphate reductase. The prosi 98.15
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 98.15
PF00171462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 98.13
PRK09847494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 98.13
cd07084442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 98.08
TIGR02518488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 98.06
cd07082473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 98.05
PRK119041038 bifunctional proline dehydrogenase/pyrroline-5-car 98.05
cd07126489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 98.02
TIGR01722477 MMSDH methylmalonic acid semialdehyde dehydrogenas 97.99
cd07077397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 97.92
cd07078432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 97.91
cd07116479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 97.88
PLN02418718 delta-1-pyrroline-5-carboxylate synthase 97.87
PRK11809 1318 putA trifunctional transcriptional regulator/proli 97.81
KOG2450|consensus501 97.71
cd07080422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 97.7
cd06534367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 97.66
TIGR01092715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 97.32
KOG2456|consensus477 97.07
KOG2454|consensus 583 97.05
KOG2453|consensus507 94.86
PF07368215 DUF1487: Protein of unknown function (DUF1487); In 94.78
KOG2452|consensus881 94.23
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 93.15
PRK13770416 histidinol dehydrogenase; Provisional 91.73
TIGR00069393 hisD histidinol dehydrogenase. This model describe 90.51
PF00815412 Histidinol_dh: Histidinol dehydrogenase; InterPro: 88.61
cd06572390 Histidinol_dh Histidinol dehydrogenase, HisD, E.C 86.45
PRK12447426 histidinol dehydrogenase; Reviewed 85.59
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
Probab=100.00  E-value=1.2e-74  Score=607.88  Aligned_cols=373  Identities=40%  Similarity=0.722  Sum_probs=333.6

Q ss_pred             ccHHHHHHHHHHHhhhCCCCCHHHHHHHHHHHHHHHHHhHHHHHHHHHHhhcCChhHHHHHHHHHHHHHHHHHHHHhHhh
Q psy15673          2 VNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQW   81 (484)
Q Consensus         2 ~~v~~av~~A~~A~~~w~~~~~~~R~~~L~~~a~~l~~~~~el~~~~~~e~Gk~~~~a~~~ev~~~~~~l~~~~~~~~~~   81 (484)
                      .|+++++++|++||+.|+.+|+.+|.++|+++++.|++|+|+|++++++|+|||..++...|+..+++.++|+++.+++|
T Consensus        10 ~~v~~av~~a~~af~~w~~~~~~~R~~~L~~~a~~l~~~~~ela~~l~~e~GKp~~~a~~~Ev~~~~~~~~~~~~~~~~~   89 (484)
T PLN02174         10 ADASILVTELRRSFDDGVTRGYEWRVTQLKKLMIICDNHEPEIVAALRDDLGKPELESSVYEVSLLRNSIKLALKQLKNW   89 (484)
T ss_pred             HHHHHHHHHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            47899999999999999999999999999999999999999999999999999999997679999999999999999988


Q ss_pred             hcCCCCCccccccCCceeeeecCceEEEEEcCCCcchHhhHHHHHHHHHcCCEEEEecCCCChhHHHHHHHHcccccCCC
Q psy15673         82 MTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDND  161 (484)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~p~N~P~~~~~~~l~~ALaaGN~VVlKps~~~p~~~~~l~~ll~~alP~g  161 (484)
                      .++..............++.++|+|||++|+|||||+.+.++++++||++||+||+|||+.+|+++.++++++.+++|+|
T Consensus        90 ~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~~~~~ALaaGN~VVlKPse~tp~~~~~l~~l~~~~lp~g  169 (484)
T PLN02174         90 MAPEKAKTSLTTFPASAEIVSEPLGVVLVISAWNYPFLLSIDPVIGAISAGNAVVLKPSELAPASSALLAKLLEQYLDSS  169 (484)
T ss_pred             hcccccccccccCCcceEEEEecceEEEEECCCccHHHHHHHHHHHHHHcCCEEEEECCCCCHHHHHHHHHHHHHhCCCC
Confidence            77543221111223357899999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEEeCCHHHHHHHHhcCCCEEEEeCChhHHHHHHHHHhcCCCCeEEecCCcCeEEEcCCCCHHHHHHHHHhhhc-ccC
Q psy15673        162 TFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKC-INA  240 (484)
Q Consensus       162 vv~vv~g~~~~~~~L~~~~v~~V~ftGs~~~g~~I~~~aa~~l~~v~lelgGk~p~IV~~dADl~~aa~~iv~~~~-~~~  240 (484)
                      ++|+|+|+.+.+..|+.+++|+|+||||+++|+.|++.++++++|+++|||||||+||++|||++.|++.+++++| .|+
T Consensus       170 vv~vv~G~~~~~~~l~~~~vd~V~FTGS~~~G~~I~~~aa~~l~~v~LELGGk~p~iV~~dADl~~Aa~~i~~g~f~~n~  249 (484)
T PLN02174        170 AVRVVEGAVTETTALLEQKWDKIFYTGSSKIGRVIMAAAAKHLTPVVLELGGKSPVVVDSDTDLKVTVRRIIAGKWGCNN  249 (484)
T ss_pred             EEEEEECChHHHHHHhcccCCEEEEECChHHHHHHHHHHHhcCCcEEEecCCCCeEEEcCCCCHHHHHHHHHHHHhhCCC
Confidence            9999999777777777669999999999999999999999999999999999999999999999999999999999 699


Q ss_pred             CCccccCCeeEeehhHHHHHHHHHHHHHhhhhhcccccccccccccCccccccccccccccccCchhhHhhhcCCccccc
Q psy15673        241 GQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDS  320 (484)
Q Consensus       241 GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  320 (484)
                      ||.|++++|+|||++++|+|+++|++.+++++.                                               
T Consensus       250 GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~~~~-----------------------------------------------  282 (484)
T PLN02174        250 GQACISPDYILTTKEYAPKVIDAMKKELETFYG-----------------------------------------------  282 (484)
T ss_pred             CCCCCcCcEEEEeHHHHHHHHHHHHHHHHhhcC-----------------------------------------------
Confidence            999999999999999999999999999988764                                               


Q ss_pred             cccHHHHHHHhhhcccccCCCeeccCCeeeechhhHHHHHHHHHHHHHHHhccccCCCCCccccCCHHHHHHHHHhhhc-
Q psy15673        321 SVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHS-  399 (484)
Q Consensus       321 ~a~l~~a~~~~~~g~~~~~gq~c~ap~~~~v~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~pi~~~~~~~~~~~~~~~-  399 (484)
                                                                         |+|.+ ++++||++++.+++++.+++++ 
T Consensus       283 ---------------------------------------------------G~p~~-~~~~Gpli~~~~~~~v~~~i~~a  310 (484)
T PLN02174        283 ---------------------------------------------------KNPME-SKDMSRIVNSTHFDRLSKLLDEK  310 (484)
T ss_pred             ---------------------------------------------------CCCcc-cCCcCCCCCHHHHHHHHHHHHHH
Confidence                                                               66665 7899999999999999999984 


Q ss_pred             --CceEEeCCCCCCCCCcE----EecCC----------------C----CHHH--------------------------H
Q psy15673        400 --SGTIALGGDMDASDRPL----YIDSS----------------V----NIEL--------------------------A  427 (484)
Q Consensus       400 --~~~~~~gg~~~~~~~~~----~~~~~----------------v----~~~e--------------------------~  427 (484)
                        |+++++||..+..|.|+    +.+++                |    |.||                          +
T Consensus       311 ~~ga~~~~GG~~~~~g~~~~PTvl~~v~~~~~i~~eEiFGPVl~v~~~~~~~eai~~aN~~~~gLaa~vft~d~~~a~~~  390 (484)
T PLN02174        311 EVSDKIVYGGEKDRENLKIAPTILLDVPLDSLIMSEEIFGPLLPILTLNNLEESFDVIRSRPKPLAAYLFTHNKKLKERF  390 (484)
T ss_pred             HcCCEEEECCCcCCCCCEEEEEEEecCCCCChhhcCCcCCCeEEEecCCCHHHHHHHHhCCCCCeEEEEEcCCHHHHHHH
Confidence              78899999765446666    66666                1    5666                          3


Q ss_pred             Hhhhc-cceEEcCccc--------ccCccCCC-CcccccchHhhccccceeeecCC
Q psy15673        428 VRRFL-WGKCINAGQL--------TRGPGWDR-LEYHGKYSFVTFTHRKSCLVKDY  473 (484)
Q Consensus       428 ~~~~~-G~v~iN~~~~--------~GG~~~SG-G~~~g~~~~~~~~~~k~i~~~~~  473 (484)
                      +++++ |+|+||+...        +||+|+|| |+++|.+|+++||+.|+|+++..
T Consensus       391 ~~~l~aG~v~IN~~~~~~~~~~~PfGG~k~SG~Gr~~G~~gl~~ft~~K~v~~~~~  446 (484)
T PLN02174        391 AATVSAGGIVVNDIAVHLALHTLPFGGVGESGMGAYHGKFSFDAFSHKKAVLYRSL  446 (484)
T ss_pred             HHcCCcceEEECCCcCCCCCCCCCCCCcCccccCccchHHHHHHhcceEEEEECCc
Confidence            44556 9999998532        29999999 99999999999999999998753



>KOG2451|consensus Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>KOG2450|consensus Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>KOG2450|consensus Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>PF07368 DUF1487: Protein of unknown function (DUF1487); InterPro: IPR009961 This family consists of several uncharacterised proteins from Drosophila melanogaster Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK13770 histidinol dehydrogenase; Provisional Back     alignment and domain information
>TIGR00069 hisD histidinol dehydrogenase Back     alignment and domain information
>PF00815 Histidinol_dh: Histidinol dehydrogenase; InterPro: IPR012131 Histidinol dehydrogenase (HDH) catalyzes the terminal step in the biosynthesis of histidine in bacteria, fungi, and plants, the four-electron oxidation of L-histidinol to histidine Back     alignment and domain information
>cd06572 Histidinol_dh Histidinol dehydrogenase, HisD, E Back     alignment and domain information
>PRK12447 histidinol dehydrogenase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
1ad3_A452 Class 3 Aldehyde Dehydrogenase Complex With Nicotin 1e-63
3sza_A469 Crystal Structure Of Human Aldh3a1 - Apo Form Lengt 2e-63
3lv1_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 5e-40
3lns_A457 Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehy 7e-39
4h7n_A474 The Structure Of Putative Aldehyde Dehydrogenase Pu 1e-18
3r31_A517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 3e-18
2wox_A489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 9e-18
2wme_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-17
2xdr_A489 Crystallographic Structure Of Betaine Aldehyde Dehy 5e-17
1a4s_A503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 6e-17
3zqa_A490 Crystallographic Structure Of Betaine Aldehyde Dehy 1e-16
2wme_C490 Crystallographic Structure Of Betaine Aldehyde Dehy 2e-16
3b4w_A495 Crystal Structure Of Mycobacterium Tuberculosis Ald 2e-16
4i9b_A517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 5e-15
3ed6_A520 1.7 Angstrom Resolution Crystal Structure Of Betain 6e-15
3k2w_A497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 1e-14
4a0m_A496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 2e-14
3i44_A497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 3e-14
4i8q_A514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 3e-14
2imp_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 4e-14
2o2p_A517 Crystal Structure Of The C-Terminal Domain Of Rat 1 4e-14
2hg2_A479 Structure Of Lactaldehyde Dehydrogenase Length = 47 4e-14
2opx_A479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 5e-14
4i8p_A520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 5e-14
3iwk_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 6e-14
3iwj_A503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 7e-14
3rhm_A517 Crystal Structure Of The E673q Mutant Of C-Terminal 1e-13
3rhj_A517 Crystal Structure Of The E673a Mutant Of The C-Term 2e-13
1bi9_A499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 2e-13
3rhr_A517 Crystal Structure Of The C707a Mutant Of The C-Term 5e-13
4gnz_A517 Crystal Structure Of The C707s Mutant Of C-terminal 6e-13
1bxs_A501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 7e-13
2d4e_A515 Crystal Structure Of The Hpcc From Thermus Thermoph 2e-12
3rhl_A517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 3e-12
2w8n_A487 The Crytal Structure Of The Oxidized Form Of Human 4e-12
3ty7_A478 Crystal Structure Of Aldehyde Dehydrogenase Family 5e-12
3ifg_A484 Crystal Structure Of Succinate-Semialdehyde Dehydro 6e-12
1o9j_A501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 9e-12
1ag8_A499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 1e-11
1cw3_A494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 2e-11
2onn_A500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 2e-11
1zum_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 2e-11
1o05_A500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 2e-11
3jz4_A481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 3e-11
3jz4_C481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 3e-11
4fr8_A500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 3e-11
4dal_A498 Crystal Structure Of Putative Aldehyde Dehydrogenas 4e-11
2w8p_A487 The Crystal Structure Of Human C340a Ssadh Length = 6e-11
3n81_A500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 7e-11
1wnb_A495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 1e-10
3inl_A500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 3e-10
1nzw_A500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 3e-10
3n80_A500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 3e-10
3ju8_A490 Crystal Structure Of Succinylglutamic Semialdehyde 3e-10
4dng_A485 Crystal Structure Of Putative Aldehyde Dehydrogenas 8e-10
3rjl_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 9e-10
1euh_A475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 1e-09
2id2_A475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 3e-09
3u4j_A528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 3e-09
3pqa_A486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 4e-09
3qan_A538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 4e-09
2esd_A475 Crystal Structure Of Thioacylenzyme Intermediate Of 5e-09
1qi1_A475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 1e-08
3ek1_A504 Crystal Structure Of Aldehyde Dehydrogenase From Br 2e-08
2jg7_A510 Crystal Structure Of Seabream Antiquitin And Elucid 1e-07
1t90_A486 Crystal Structure Of Methylmalonate Semialdehyde De 9e-07
2j6l_A500 Structure Of Aminoadipate-Semialdehyde Dehydrogenas 1e-06
1uxn_A501 Structural Basis For Allosteric Regulation And Subs 2e-06
1uxv_A501 Structural Basis For Allosteric Regulation And Subs 2e-06
1ky8_A501 Crystal Structure Of The Non-Phosphorylating Glycer 2e-06
3prl_A505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 5e-06
3efv_A462 Crystal Structure Of A Putative Succinate-Semialdeh 9e-06
3r64_A508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 2e-05
3rh9_A506 The Crystal Structure Of Oxidoreductase From Marino 4e-05
3ros_A484 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 2e-04
1uzb_A516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 7e-04
>pdb|1AD3|A Chain A, Class 3 Aldehyde Dehydrogenase Complex With Nicotinamide- Adenine-Dinucleotide Length = 452 Back     alignment and structure

Iteration: 1

Score = 240 bits (613), Expect = 1e-63, Method: Compositional matrix adjust. Identities = 156/475 (32%), Positives = 234/475 (49%), Gaps = 50/475 (10%) Query: 2 VNFGDLVQNARDTFDSGKSKPYEFXXXXXXXXXXXYEEXXXXXXXXXXXXXRKHKQEAVL 61 ++ D V+ AR+ F+SGK++ +F E K++ + Sbjct: 1 MSISDTVKRAREAFNSGKTRSLQFRIQQLEALQRMINENLKSISGALASDLGKNEWTSYY 60 Query: 62 FEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLS 121 E+ + ++ T+ L W E K D +YI+ +P GV L+IGAWNYP L+ Sbjct: 61 EEVAHVLEELDTTIKELPDWAEDEPVAKTRQTQQDDLYIHSEPLGVVLVIGAWNYPFNLT 120 Query: 122 LLPXXXXXXXXXXXXLKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHRF 181 + P LKPSEV+ A ++A L+P+Y+D + + VV GGV ETTELLK RF Sbjct: 121 IQPMVGAVAAGNAVILKPSEVSGHMADLLATLIPQYMDQNLYLVVKGGVPETTELLKERF 180 Query: 182 DYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAG 241 D+I YTGST+VGKIV AA +HLTPVTLELGGKSP Y+D ++++A RR WGK +N+G Sbjct: 181 DHIMYTGSTAVGKIVMAAAAKHLTPVTLELGGKSPCYVDKDCDLDVACRRIAWGKFMNSG 240 Query: 242 QTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCL 301 QTC+APDYILC +Q QI+ + K L +Y E R +G+ + R L Sbjct: 241 QTCVAPDYILCDPSIQNQIVEKLKKSLKDFYGEDAKQSRD----YGRIINDRHFQRVKGL 296 Query: 302 VKDYNPVLEALS---APLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQA- 357 + D V + + YI ++ +++ + + + I + P I+C R ++ Sbjct: 297 I-DNQKVAHGGTWDQSSRYIAPTILVDVDPQSPVMQEEIFGP---VMP--IVCVRSLEEA 350 Query: 358 -QILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSSGTIALGGDMDASDRPL 416 Q +NQ + L Y ++K +++ + S G A Sbjct: 351 IQFINQREKPL-----------ALYVFSNNEKVIKKMIAETSSGGVTA------------ 387 Query: 417 YIDSSVNIELAVRRFLWGKCINAGQLTRGPGWDRLEYHGKYSFVTFTHRKSCLVK 471 + V + + V +G N+G YHGK SF TF+HR+SCLVK Sbjct: 388 ---NDVIVHITVPTLPFGGVGNSGMGA---------YHGKKSFETFSHRRSCLVK 430
>pdb|3SZA|A Chain A, Crystal Structure Of Human Aldh3a1 - Apo Form Length = 469 Back     alignment and structure
>pdb|3LV1|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ Length = 457 Back     alignment and structure
>pdb|3LNS|A Chain A, Benzaldehyde Dehydrogenase, A Class 3 Aldehyde Dehydrogenase, With Bound Nadp+ And Benzoate Adduct Length = 457 Back     alignment and structure
>pdb|4H7N|A Chain A, The Structure Of Putative Aldehyde Dehydrogenase Puta From Anabaena Variabilis. Length = 474 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|3B4W|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Aldehyde Dehydrogenase Complexed With Nad+ Length = 495 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|2JG7|A Chain A, Crystal Structure Of Seabream Antiquitin And Elucidation Of Its Substrate Specificity Length = 510 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure
>pdb|2J6L|A Chain A, Structure Of Aminoadipate-Semialdehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|1UXN|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1UXV|A Chain A, Structural Basis For Allosteric Regulation And Substrate Specificity Of The Non-Phosphorylating Glyceraldehyde-3-Phosphate Dehydrogenase (Gapn) From Thermoproteus Tenax Length = 501 Back     alignment and structure
>pdb|1KY8|A Chain A, Crystal Structure Of The Non-Phosphorylating Glyceraldehyde-3- Phosphate Dehydrogenase Length = 501 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|3RH9|A Chain A, The Crystal Structure Of Oxidoreductase From Marinobacter Aquaeolei Length = 506 Back     alignment and structure
>pdb|3ROS|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Lactobacillus Acidophilus Length = 484 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query484
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 1e-153
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 2e-38
3sza_A 469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 4e-07
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 8e-06
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 4e-05
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 1e-148
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 1e-24
3lns_A 457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 2e-07
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 7e-06
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 3e-05
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 7e-47
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 1e-46
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 2e-43
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 5e-42
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 7e-42
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 3e-41
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 9e-41
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 2e-40
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 1e-39
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 1e-39
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 2e-39
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 7e-39
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 1e-38
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 3e-04
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 1e-38
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 1e-38
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 2e-38
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 7e-38
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 7e-38
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 4e-04
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 1e-37
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 1e-37
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 6e-04
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 3e-37
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 4e-37
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 1e-36
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 1e-36
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 6e-04
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 2e-36
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 2e-36
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 3e-35
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 5e-35
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 9e-35
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 3e-34
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 6e-34
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 3e-33
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 1e-32
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 2e-31
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 2e-28
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 2e-24
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 1e-22
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 2e-22
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 2e-22
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 3e-22
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 4e-22
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 4e-20
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 2e-19
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 1e-16
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-07
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
 Score =  444 bits (1145), Expect = e-153
 Identities = 133/274 (48%), Positives = 185/274 (67%)

Query: 1   MVNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAV 60
           M    + V+ AR  F SG+++P +FR +QL+ L RL +E +Q+L  ALAADL K++  A 
Sbjct: 17  MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY 76

Query: 61  LFEIEFLANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQL 120
             E+ ++  ++   +  L +W   E   K      D +YI+ +P GV L+IG WNYP  L
Sbjct: 77  YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL 136

Query: 121 SLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDNDTFQVVLGGVEETTELLKHR 180
           ++ P  GAIAAGN V+LKPSE++   A ++A ++P+YLD D + V+ GGV ETTELLK R
Sbjct: 137 TIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER 196

Query: 181 FDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINA 240
           FD+I YTGST VGKI+  AA +HLTPVTLELGGKSP Y+D + ++++A RR  WGK +N+
Sbjct: 197 FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS 256

Query: 241 GQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTE 274
           GQTC+APDYILC   +Q QI+ + K  L  +Y E
Sbjct: 257 GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGE 290


>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} PDB: 3szb_A* 1ad3_A* Length = 469 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Length = 457 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query484
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 100.0
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 100.0
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 100.0
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 100.0
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 100.0
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 100.0
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 100.0
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 100.0
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 100.0
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 100.0
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 100.0
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 100.0
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 100.0
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 100.0
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 100.0
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 100.0
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 100.0
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 100.0
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 100.0
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 100.0
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 100.0
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 100.0
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 100.0
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 100.0
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 100.0
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 100.0
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 100.0
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 100.0
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 100.0
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 100.0
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 100.0
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 100.0
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 100.0
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 100.0
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 100.0
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 100.0
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 100.0
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 100.0
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 100.0
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 100.0
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 100.0
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 100.0
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 100.0
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 100.0
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 100.0
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 100.0
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 100.0
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 100.0
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 100.0
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 100.0
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 100.0
1ez0_A510 ALDH, aldehyde dehydrogenase; nucleotide binding d 98.67
3sza_A469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 98.6
3ros_A484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 98.56
2wme_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 98.55
3rh9_A506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 98.54
1bxs_A501 Aldehyde dehydrogenase; retinal, class 1, tetramer 98.51
3k2w_A497 Betaine-aldehyde dehydrogenase; structural genomic 98.5
2d4e_A515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 98.5
3iwj_A503 Putative aminoaldehyde dehydrogenase; rossmann fol 98.49
1wnd_A495 Putative betaine aldehyde dehydrogenase; NADH, flu 98.49
1o04_A500 Aldehyde dehydrogenase, mitochondrial precursor; A 98.49
3lns_A457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 98.49
3ifg_A484 Succinate-semialdehyde dehydrogenase (NADP+); niai 98.49
2imp_A479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 98.49
1a4s_A503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 98.49
3prl_A505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 98.49
3u4j_A528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 98.48
4e4g_A521 Methylmalonate-semialdehyde dehydrogenase; structu 98.48
3qan_A538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 98.48
2w8n_A487 Succinate-semialdehyde dehydrogenase, mitochondria 98.47
3r31_A517 BADH, betaine aldehyde dehydrogenase; structural g 98.47
3b4w_A495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 98.46
3r64_A508 NAD dependent benzaldehyde dehydrogenase; structur 98.45
4e3x_A563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 98.45
1uzb_A516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 98.44
3pqa_A486 Lactaldehyde dehydrogenase; structural genomics, p 98.43
2j6l_A500 Aldehyde dehydrogenase family 7 member A1; NAD, re 98.43
4f3x_A498 Putative aldehyde dehydrogenase; structural genomi 98.43
3ty7_A478 Putative aldehyde dehydrogenase SAV2122; structura 98.43
3ek1_A504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 98.43
4h7n_A474 Aldehyde dehydrogenase; structural genomics, PSI-b 98.42
2ve5_A490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 98.42
3jz4_A481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 98.42
3ed6_A520 Betaine aldehyde dehydrogenase; structural genomic 98.41
4dng_A485 Uncharacterized aldehyde dehydrogenase ALDY; struc 98.39
1vlu_A468 Gamma-glutamyl phosphate reductase; YOR323C, struc 98.39
1uxt_A501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 98.39
3etf_A462 Putative succinate-semialdehyde dehydrogenase; cen 98.38
1euh_A475 NADP dependent non phosphorylating glyceraldehyde- 98.37
2o2p_A517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 98.37
4ghk_A444 Gamma-glutamyl phosphate reductase; structural gen 98.37
2y53_A534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 98.35
3k9d_A464 LMO1179 protein, aldehyde dehydrogenase; structura 98.33
3i44_A497 Aldehyde dehydrogenase; oxidoreductase, structural 98.32
3v4c_A528 Aldehyde dehydrogenase (NADP+); structural genomic 98.32
3ju8_A490 Succinylglutamic semialdehyde dehydrogenase; alpha 98.26
1t90_A486 MMSDH, probable methylmalonate-semialdehyde dehydr 98.25
4f9i_A1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 98.25
3haz_A1001 Proline dehydrogenase; proline utilization A, PUTA 98.2
1o20_A427 Gamma-glutamyl phosphate reductase; TM0293, struct 98.2
3my7_A452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 98.13
2h5g_A463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 98.09
4gic_A423 HDH, histidinol dehydrogenase; protein structure i 94.18
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
Probab=100.00  E-value=4.1e-76  Score=620.70  Aligned_cols=375  Identities=45%  Similarity=0.783  Sum_probs=339.2

Q ss_pred             CccHHHHHHHHHHHhhhCCCCCHHHHHHHHHHHHHHHHHhHHHHHHHHHHhhcCChhHHHHHHHHHHHHHHHHHHHHhHh
Q psy15673          1 MVNFGDLVQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHLKQ   80 (484)
Q Consensus         1 ~~~v~~av~~A~~A~~~w~~~~~~~R~~~L~~~a~~l~~~~~el~~~~~~e~Gk~~~~a~~~ev~~~~~~l~~~~~~~~~   80 (484)
                      |+++++++++|++||+.|+.+|.++|.++|+++++.|++++++|++++++|+|||..+++..|+..+++.++++++.++.
T Consensus        17 ~~dv~~av~aA~~A~~~w~~~~~~~R~~~L~~~a~~l~~~~~ela~~~~~e~Gk~~~ea~~~ev~~~~~~~~~~~~~~~~   96 (469)
T 3sza_A           17 MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAYYEEVVYVLEEIEYMIQKLPE   96 (469)
T ss_dssp             -CHHHHHHHHHHHHHHTTTTCSHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHCCCHHHHHHTTHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhccCCHHHHHHHHHHHHHHHHHhHHHHHHHHHHHhCCCHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            57899999999999999999999999999999999999999999999999999999999766999999999999999988


Q ss_pred             hhcCCCCCccccccCCceeeeecCceEEEEEcCCCcchHhhHHHHHHHHHcCCEEEEecCCCChhHHHHHHHHcccccCC
Q psy15673         81 WMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKYLDN  160 (484)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~p~N~P~~~~~~~l~~ALaaGN~VVlKps~~~p~~~~~l~~ll~~alP~  160 (484)
                      |..+..............++.++|+|||++|+|||||+.+.++++++||++||+||+|||+.+|.++..+++++.+++|+
T Consensus        97 ~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~~~~~ALaaGN~vVlKps~~tp~t~~~l~~l~~~alP~  176 (469)
T 3sza_A           97 WAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNLTIQPMVGAIAAGNAVVLKPSELSENMASLLATIIPQYLDK  176 (469)
T ss_dssp             HHSCEECCCCGGGTTSEEEEEEEECSEEEEECCSSSTTHHHHHHHHHHHHTTCEEEEECCTTSHHHHHHHHHHHHHHSCT
T ss_pred             hhcccccCccccCCCccceeeccCCCEEEEECCCcchHHHHHHHHHHHHHcCCEEEEECCCCChHHHHHHHHHHHHhCCc
Confidence            87654322222223446789999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEEeCCHHHHHHHHhcCCCEEEEeCChhHHHHHHHHHhcCCCCeEEecCCcCeEEEcCCCCHHHHHHHHHhhhcccC
Q psy15673        161 DTFQVVLGGVEETTELLKHRFDYIFYTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINA  240 (484)
Q Consensus       161 gvv~vv~g~~~~~~~L~~~~v~~V~ftGs~~~g~~I~~~aa~~l~~v~lelgGk~p~IV~~dADl~~aa~~iv~~~~~~~  240 (484)
                      |++|+|+|+.+.+..|+.|++|+|+||||+++|+.|++.+++++||+++|||||||+||++|||++.|++.+++++|.|+
T Consensus       177 gvv~vv~g~~~~~~~ll~~~vd~I~FTGS~~vG~~i~~~aa~~lkpv~lELGGk~p~iV~~dADl~~Aa~~i~~~~~~n~  256 (469)
T 3sza_A          177 DLYPVINGGVPETTELLKERFDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS  256 (469)
T ss_dssp             TTSCBCCCSHHHHHHHTTSCCSEEEEESCHHHHHHHHHHHHTTTCCEEEECCCCCEEEECTTSCHHHHHHHHHHHHHGGG
T ss_pred             ceEEEEECCHHHHHHHHhcCCCEEEEECCHHHHHHHHHHHhhccCceEEecCCCCceEECCCCCHHHHHHHHHHHHHhcC
Confidence            99999999888888898889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccccCCeeEeehhHHHHHHHHHHHHHhhhhhcccccccccccccCccccccccccccccccCchhhHhhhcCCccccc
Q psy15673        241 GQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSAPLYIDS  320 (484)
Q Consensus       241 GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  320 (484)
                      ||.|++++|||||++++|+|+++|++++++++                                                
T Consensus       257 GQ~C~a~~rvlV~~~i~d~f~~~l~~~~~~~~------------------------------------------------  288 (469)
T 3sza_A          257 GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFY------------------------------------------------  288 (469)
T ss_dssp             GCCTTSCCEEEECGGGHHHHHHHHHHHHHHHH------------------------------------------------
T ss_pred             CCCCCCCcEEEEehhHHHHHHHHHHHHHHHhc------------------------------------------------
Confidence            99999999999999999999999999887653                                                


Q ss_pred             cccHHHHHHHhhhcccccCCCeeccCCeeeechhhHHHHHHHHHHHHHHHhccccCCCCCccccCCHHHHHHHHHhhhcC
Q psy15673        321 SVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLKSLVHSS  400 (484)
Q Consensus       321 ~a~l~~a~~~~~~g~~~~~gq~c~ap~~~~v~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~pi~~~~~~~~~~~~~~~~  400 (484)
                                                                         |++.++++++||++++.+++++.+++ +|
T Consensus       289 ---------------------------------------------------g~~~~~~~~~gpli~~~~~~rv~~~i-~g  316 (469)
T 3sza_A          289 ---------------------------------------------------GEDAKKSRDYGRIISARHFQRVMGLI-EG  316 (469)
T ss_dssp             ---------------------------------------------------CSCGGGCTTCCCCSCHHHHHHHHHHH-TT
T ss_pred             ---------------------------------------------------CCCCcccCcccccCCHHHHHHHHHHH-cC
Confidence                                                               66777888999999999999999999 59


Q ss_pred             ceEEeCCCCCCCCCcE----EecCC----------------C----CHHH--------------------------HHhh
Q psy15673        401 GTIALGGDMDASDRPL----YIDSS----------------V----NIEL--------------------------AVRR  430 (484)
Q Consensus       401 ~~~~~gg~~~~~~~~~----~~~~~----------------v----~~~e--------------------------~~~~  430 (484)
                      ++++.||..+..|+|+    +.+++                |    |+||                          ++++
T Consensus       317 a~v~~GG~~~~~g~~~~PTvl~~v~~~~~i~~eEiFGPVl~v~~~~~~deAi~~aN~~~~gLaa~v~t~d~~~a~~~~~~  396 (469)
T 3sza_A          317 QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREKPLALYMFSSNDKVIKKMIAE  396 (469)
T ss_dssp             SEEEECCCEETTTTEECCEEEESCCTTSGGGTSCCCSSEEEEEECSSHHHHHHHHHHSCCCSEEEEECSCHHHHHHHHHH
T ss_pred             CEEEeCCccCCCCceeCCeeecCCCCcchhhhccccCCeEEEEecCCHHHHHHHHHcCCCCceEEEECCCHHHHHHHHHh
Confidence            9999999865566776    66766                1    6666                          3345


Q ss_pred             hc-cceEEcCccc--------ccCccCCC-CcccccchHhhccccceeeecCCCc
Q psy15673        431 FL-WGKCINAGQL--------TRGPGWDR-LEYHGKYSFVTFTHRKSCLVKDYNP  475 (484)
Q Consensus       431 ~~-G~v~iN~~~~--------~GG~~~SG-G~~~g~~~~~~~~~~k~i~~~~~~~  475 (484)
                      ++ |+|+||+...        +||+|+|| |+++|.+|+++||+.|+|+++.++.
T Consensus       397 l~~G~V~vN~~~~~~~~~~~PfGG~k~SG~Gr~~G~~g~~~ft~~K~v~~~~~~~  451 (469)
T 3sza_A          397 TSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFETFSHRRSCLVRPLMN  451 (469)
T ss_dssp             CCCSEEEESCSSGGGSCTTSCBCCCGGGEECCBSTHHHHHHTEEEEEEEECCSSC
T ss_pred             CCcceEEEeCCCCCCCCCCCCcCCccccccCccchHHHHHHhhCeeEEEECCccc
Confidence            55 9999999742        29999999 9999999999999999999997765



>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>4gic_A HDH, histidinol dehydrogenase; protein structure initiative, STR genomics, PSI-biology, NEW YORK structural genomics researc consortium; 2.05A {Methylococcus capsulatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 484
d1a4sa_503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-48
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 3e-48
d1ad3a_446 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 0.001
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 5e-45
d1o04a_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-04
d1bxsa_494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 8e-44
d1wnda_474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 4e-42
d1euha_474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 7e-27
d1ky8a_499 c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3 2e-15
d1uzba_516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 5e-15
d1o20a_414 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 1e-12
d1vlua_436 c.82.1.1 (A:) Gamma-glutamyl phosphate reductase { 6e-09
d1ez0a_504 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 8e-05
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Baltic cod (Gadus callarias) [TaxId: 8053]
 Score =  171 bits (434), Expect = 3e-48
 Identities = 70/267 (26%), Positives = 106/267 (39%), Gaps = 7/267 (2%)

Query: 8   VQNARDTFDSGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFL 67
           VQ+A+  +          R R + +  R+  E + ++A     +  K   EA        
Sbjct: 64  VQSAQAAYLKWSKMAGIERSRVMLEAARIIRERRDNIAKLEVINNGKTITEAEYDIDAAW 123

Query: 68  ANDVRNTLNHLKQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAG 127
                             +                +P GVC  I AWNYP  ++    A 
Sbjct: 124 QCIEYYAGLAPTLSGQHIQLPGGAFAY-----TRREPLGVCAGILAWNYPFMIAAWKCAP 178

Query: 128 AIAAGNVVILKPSEVAPASAKIMAELLPKY-LDNDTFQVVLGGVEETTELLKH-RFDYIF 185
           A+A GN V+ KPS + P +  I+AE+  +  +      VV GG E  + L  H     + 
Sbjct: 179 ALACGNAVVFKPSPMTPVTGVILAEIFHEAGVPVGLVNVVQGGAETGSLLCHHPNVAKVS 238

Query: 186 YTGSTSVGKIVRQAANEHLTPVTLELGGKSPLYIDSSVNIELAVRRFLWGKCINAGQTCI 245
           +TGS   GK V + + + +  VTLELGGKSPL I     +E AVR  L    +  GQ C 
Sbjct: 239 FTGSVPTGKKVMEMSAKTVKHVTLELGGKSPLLIFKDCELENAVRGALMANFLTQGQVCT 298

Query: 246 APDYILCSRQVQAQILNQAKAVLDSWY 272
               +   R++  Q L +      +  
Sbjct: 299 NGTRVFVQREIMPQFLEEVVKRTKAIV 325


>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 446 Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Length = 499 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Length = 414 Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 436 Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Length = 504 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query484
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 100.0
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 100.0
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 100.0
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 100.0
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 100.0
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 100.0
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 100.0
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 100.0
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 100.0
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 100.0
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 100.0
d1ad3a_446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 98.32
d1bxsa_494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 98.23
d1ky8a_499 Non-phosphorylating glyceraldehyde-3-phosphate deh 98.22
d1wnda_474 Putative betaine aldehyde dehydrogenase YdcW {Esch 98.19
d1o04a_494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 98.19
d1uzba_516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 98.17
d1a4sa_503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 98.06
d1euha_474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 97.81
d1o20a_414 Gamma-glutamyl phosphate reductase {Thermotoga mar 97.38
d1ez0a_504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 96.64
d1vlua_436 Gamma-glutamyl phosphate reductase {Baker's yeast 95.04
d1k75a_431 L-histidinol dehydrogenase HisD {Escherichia coli 89.49
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=100.00  E-value=3e-71  Score=586.70  Aligned_cols=370  Identities=22%  Similarity=0.320  Sum_probs=330.3

Q ss_pred             ccHHHHHHHHHHHhh---hCCCCCHHHHHHHHHHHHHHHHHhHHHHHHHHHHhhcCChhHHHHHHHHHHHHHHHHHHHHh
Q psy15673          2 VNFGDLVQNARDTFD---SGKSKPYEFRRRQLQQLVRLYEENQQDLANALAADLRKHKQEAVLFEIEFLANDVRNTLNHL   78 (484)
Q Consensus         2 ~~v~~av~~A~~A~~---~w~~~~~~~R~~~L~~~a~~l~~~~~el~~~~~~e~Gk~~~~a~~~ev~~~~~~l~~~~~~~   78 (484)
                      +|++.|+++|++||+   .|+.+|.++|.++|++++++|++++++|++++++|+|||..++...|+..+++.+++++...
T Consensus        51 ~dvd~Av~aA~~Af~a~~~W~~~s~~eR~~iL~kia~~L~~~~eela~l~~~E~Gk~~~e~~~~ev~~~~~~~~~~a~~~  130 (494)
T d1bxsa_          51 EDVDKAVKAARQAFQIGSPWRTMDASERGRLLNKLADLIERDRLLLATMEAMNGGKLFSNAYLMDLGGCIKTLRYCAGWA  130 (494)
T ss_dssp             HHHHHHHHHHHHHTSTTSHHHHSCHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHTCCHHHHHHTHHHHHHHHHHHHHHHG
T ss_pred             HHHHHHHHHHHHHHhccchhhcCCHHHHHHHHHHHHHHHHhCHHHHHHHHHHhcCCchhhhhhhhhhhhhHHHHHHhhhh
Confidence            589999999999996   69999999999999999999999999999999999999999876668999999999999887


Q ss_pred             HhhhcCCCCCccccccCCceeeeecCceEEEEEcCCCcchHhhHHHHHHHHHcCCEEEEecCCCChhHHHHHHHHcccc-
Q psy15673         79 KQWMTPEKPGKDIANMLDGVYIYPDPYGVCLIIGAWNYPLQLSLLPAAGAIAAGNVVILKPSEVAPASAKIMAELLPKY-  157 (484)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~p~N~P~~~~~~~l~~ALaaGN~VVlKps~~~p~~~~~l~~ll~~a-  157 (484)
                      +++.+.....    ......++.++|+|||++|+|||||+.+.++++++||++||+||+|||+.+|+++.++++++.++ 
T Consensus       131 ~~~~~~~~~~----~~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~~i~~ALaaGN~VVlKpse~tp~~a~~l~~~~~~ag  206 (494)
T d1bxsa_         131 DKIQGRTIPM----DGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLIKEAG  206 (494)
T ss_dssp             GGCCEEEECC----SSSEEEEEEEEECCEEEEECCSSSHHHHHHHHHHHHHHTTCEEEEECCTTCCHHHHHHHHHHHHHT
T ss_pred             hhhcceeecC----CCCceeEEEEccEEEEEEEeCccchhHHHHHHHHHHHHcCCeEEEECCCCChHHHHHHHHHHHHhC
Confidence            7654332111    12346788999999999999999999999999999999999999999999999999999999999 


Q ss_pred             cCCCcEEEEeCCH-HHHHHHHhc-CCCEEEEeCChhHHHHHHHHHhc-CCCCeEEecCCcCeEEEcCCCCHHHHHHHHHh
Q psy15673        158 LDNDTFQVVLGGV-EETTELLKH-RFDYIFYTGSTSVGKIVRQAANE-HLTPVTLELGGKSPLYIDSSVNIELAVRRFLW  234 (484)
Q Consensus       158 lP~gvv~vv~g~~-~~~~~L~~~-~v~~V~ftGs~~~g~~I~~~aa~-~l~~v~lelgGk~p~IV~~dADl~~aa~~iv~  234 (484)
                      +|+|++|+|+|++ +.+..|++| ++++|+||||+.+|+.|++.+++ ++||+++|||||||+||++|||++.|++.+++
T Consensus       207 lP~gv~~~v~g~~~~~~~~l~~~p~v~~i~fTGS~~~g~~i~~~aa~~~~~~~~lElGG~np~iV~~dadl~~a~~~i~~  286 (494)
T d1bxsa_         207 FPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTEVGKLIKEAAGKSNLKRVSLELGGKSPCIVFADADLDNAVEFAHQ  286 (494)
T ss_dssp             CCTTSEEECCSCTTTHHHHHHTCTTCSEEEEESCHHHHHHHHHHHHHTTCCEEEEECCCCCEEEECTTSCHHHHHHHHHH
T ss_pred             CCcCeEEEEeCCchHHHHHHHhCCCcCEEEecCCHHHHHHHHHHhcccCCCeEEEEcCCcCcEEECcCcchhHhHHHHHH
Confidence            9999999999965 456778899 99999999999999999998885 79999999999999999999999999999999


Q ss_pred             hhcccCCCccccCCeeEeehhHHHHHHHHHHHHHhhhhhcccccccccccccCccccccccccccccccCchhhHhhhcC
Q psy15673        235 GKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQEILPRQGLAYHGKYSFNTFTHRKSCLVKDYNPVLEALSA  314 (484)
Q Consensus       235 ~~~~~~GQ~C~a~~rv~V~~~i~d~f~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  314 (484)
                      ++|.|+||.|++++|||||++++|+|+++|++++++++.                                         
T Consensus       287 ~~~~~~GQ~C~a~~rv~V~~~~~d~f~~~l~~~~~~~~~-----------------------------------------  325 (494)
T d1bxsa_         287 GVFYHQGQCCIAASRLFVEESIYDEFVRRSVERAKKYVL-----------------------------------------  325 (494)
T ss_dssp             HHHTTTTCCTTCCCEEEEEHHHHHHHHHHHHHHHTCCCB-----------------------------------------
T ss_pred             HHhcCCCcccccceEEecccchhHHHHHHHHhhhhheee-----------------------------------------
Confidence            999999999999999999999999999999999988764                                         


Q ss_pred             CccccccccHHHHHHHhhhcccccCCCeeccCCeeeechhhHHHHHHHHHHHHHHHhccccCCCCCccccCCHHHHHHHH
Q psy15673        315 PLYIDSSVNIELAVRRFLWGKCINAGQTCIAPDYILCSRQVQAQILNQAKAVLDSWYTEQVQGSKHYCRIVSDKHFQRLK  394 (484)
Q Consensus       315 ~~~i~~~a~l~~a~~~~~~g~~~~~gq~c~ap~~~~v~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~pi~~~~~~~~~~  394 (484)
                                                                               |++.++++++||++++.+++++.
T Consensus       326 ---------------------------------------------------------g~~~~~~~~~gpli~~~~~~~~~  348 (494)
T d1bxsa_         326 ---------------------------------------------------------GNPLTPGVSQGPQIDKEQYEKIL  348 (494)
T ss_dssp             ---------------------------------------------------------SCTTSTTCCBCCCSCHHHHHHHH
T ss_pred             ---------------------------------------------------------eccCCCCCcCCCcCCHHHHHHHH
Confidence                                                                     77888899999999999999999


Q ss_pred             Hhhh----cCceEEeCCCCC-CCCCcE----EecCC----------------C----CHHH-------------------
Q psy15673        395 SLVH----SSGTIALGGDMD-ASDRPL----YIDSS----------------V----NIEL-------------------  426 (484)
Q Consensus       395 ~~~~----~~~~~~~gg~~~-~~~~~~----~~~~~----------------v----~~~e-------------------  426 (484)
                      ++++    +|++++.||... ..|.|+    +.+++                |    |.||                   
T Consensus       349 ~~i~~a~~~Ga~~~~gg~~~~~~g~~~~Ptvl~~~~~~~~~~~~E~FGPvl~v~~~~~~~eai~~~n~~~~gL~a~i~t~  428 (494)
T d1bxsa_         349 DLIESGKKEGAKLECGGGPWGNKGYFIQPTVFSDVTDDMRIAKEEIFGPVQQIMKFKSLDDVIKRANNTFYGLSAGIFTN  428 (494)
T ss_dssp             HHHHHHHHTTCEECSCCSEECSSSCEECCEEEESCCTTSHHHHSCCCSSEEEEEEECCHHHHHHHHHCSSCCSEEEEECS
T ss_pred             HHHHHHHHcCCEEEeCCCccCCCceeEcCEEEeCCCCCcHHHhccccCceEEEEEECCHHHHHHHHhCCCCCCeEEEEeC
Confidence            9886    489999988753 356665    66666                1    5666                   


Q ss_pred             -------HHhhhc-cceEEcCcccc------cCccCCC-CcccccchHhhccccceeeecCC
Q psy15673        427 -------AVRRFL-WGKCINAGQLT------RGPGWDR-LEYHGKYSFVTFTHRKSCLVKDY  473 (484)
Q Consensus       427 -------~~~~~~-G~v~iN~~~~~------GG~~~SG-G~~~g~~~~~~~~~~k~i~~~~~  473 (484)
                             ++++++ |+|+||++...      ||+|+|| |+++|.+|+++||+.|+|+++..
T Consensus       429 d~~~~~~~~~~l~~G~v~iN~~~~~~~~~PfGG~~~SG~G~~~g~~~~~~ft~~k~i~~~~~  490 (494)
T d1bxsa_         429 DIDKAITVSSALQSGTVWVNCYSVVSAQCPFGGFKMSGNGRELGEYGFHEYTEVKTVTIKIS  490 (494)
T ss_dssp             BHHHHHHHHHHSCCSEEEESCCCCCCTTSCBCCSGGGEESCBSHHHHHHTTEEEEEEEEECS
T ss_pred             CHHHHHHHHHhCCEeEEEEcCCCCcCCCCCcCccccccCChhhHHHHHHHhcceEEEEEecC
Confidence                   344555 99999987653      9999999 99999999999999999998854



>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k75a_ c.82.1.2 (A:) L-histidinol dehydrogenase HisD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure