Diaphorina citri psyllid: psy15675

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200--

MFYAPFWSKTFLENTLVDDDTTPFGEEELSRRGTLVHPYVTFFHLFFRSMAILSYMFTGLFSSSGFIASFVFIVLLLSMDFWTVKNISGRLMVGLRWWNYVDDQGKSHWVFESRKGDLQNRVNGTEARIFWTSLIVCPVMWALFLLTALFGFNFKWMLLVWIALTLNFANLYGYMKCKMGGNSDKSLMSTVSSMSSGLFFSQ

cccccccccccccccccccccccccHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccEEEEcEEEEEEcccccCEEEEEECcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccc

********************************GTLVHPYVTFFHLFFRSMAILSYMFTGLFSSSGFIASFVFIVLLLSMDFWTVKNISGRLMVGLRWWNYVDDQGKSHWVFESRKGDLQNRVNGTEARIFWTSLIVCPVMWALFLLTALFGFNFKWMLLVWIALTLNFANLYGYMKCKM****************SGLFFS*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Golgi apparatus membrane protein TVP23 homolog A		very confident	A6NH52
Golgi apparatus membrane protein TVP23 homolog B		very confident	Q29S14
Uncharacterized Golgi apparatus membrane protein-like protein CG5021		very confident	Q8IQC1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030173 [CC]	integral to Golgi membrane	probable	GO:0043229, GO:0031301, GO:0031300, GO:0005622, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044431, GO:0005794, GO:0012505, GO:0043231, GO:0044464, GO:0031228, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005768 [CC]	endosome	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted