Diaphorina citri psyllid: psy15676

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31

MDSNNNHAKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVYPPSPEPTRELLANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEWNMWKRREEEEEKEEIDEKKEEEEKEDRAMIGDRMEDGLREM

ccccccccHHHHHHEEEccccccccccccccccccccEEHHHHccccccccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHccccccccccEEEccEEEECccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccccHHHHHHHHcccccccEEEEEEEccccccccEEEEEEccHHHHHHHHHHHcccEEccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccc

******HAKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVY*************GLI***EDIDE*********************ATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEW*****************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peptidyl-prolyl cis-trans isomerase-like 4	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q5ARI5
Peptidyl-prolyl cis-trans isomerase cyp6	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q9UUE4
Peptidyl-prolyl cis-trans isomerase-like 4	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q4WAQ9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699
GO:0006417 [BP]	regulation of translation	probable	GO:0032268, GO:0009889, GO:0080090, GO:0019222, GO:0051246, GO:0060255, GO:0010608, GO:0031323, GO:2000112, GO:0050794, GO:0050789, GO:0010556, GO:0065007, GO:0031326, GO:0008150, GO:0010468
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0044732 [CC]	mitotic spindle pole body	probable	GO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0003729 [MF]	mRNA binding	probable	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F02, chain A
Confidence level:very confident
Coverage over the Query: 189-269
View the alignment between query and template
View the model in PyMOL

Template: 3BKP, chain A
Confidence level:probable
Coverage over the Query: 98-126
View the alignment between query and template
View the model in PyMOL