Psyllid ID: psy15676


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------31
MDSNNNHAKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVYPPSPEPTRELLANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEWNMWKRREEEEEKEEIDEKKEEEEKEDRAMIGDRMEDGLREM
cccccccHHHHHHHEEEccccccccccccccccccccEEHHHHccccccccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHccccccccccEEEccEEEEEccccccccccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccccHHHHHHHHcccccccEEEEEEEccccccccEEEEEEccHHHHHHHHHHHcccEEccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
ccccccccEEEEEEEEEcccccccccccccccccccccccHccccccccccccccccccccccHHHHcHHHccccEEEEEEEEcHHHHHHHHHHHHHcccccccEEEEEEEEEcccccccccccccccccccHHHHcccccccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEEccccccHHHHHHHHHccccEEEEEEEEEcccccccEEEEEEEccHHHHHHHHHHcccEEEcccEEEEEccccHHHHHcccccccccccccccccccccccccccccccccccc
mdsnnnhakcYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVfkrkndiriTHAViledpyedlpelvyppspeptRELLANgligadedidetaGLSAQEIEELRAEREAKARATILEIVgdlpeadaappenvlfvcklnpvtsdddlEIIFSRfgkvnccevirdkvtgdsLQYAFvefdnpksceDAYLKMDNVLIDDRRIHARGEEWNMWKRREEEEEKEEIDEKKEEEEKEDRAMIGDRMEDGLREM
mdsnnnhakcyiwsvvLYGSETWTMRKKEEKYLESFEMWLWRRMEkikwsdkirneEVLRRgfsfledfEIVSGISKVCNKTHRYKLAVKCVQSniivfkrkndirITHAViledpyedlpELVYPPSPEPTRELLANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDnvliddrrihargeewnmwkrreeeeekeeidekkeeeekedramigdrmedglrem
MDSNNNHAKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVYPPSPEPTRELLANGLIGADEDIDETAGLSaqeieelraereakaraTILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEWNMWkrreeeeekeeidekkeeeekedrAMIGDRMEDGLREM
*******AKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVY*************GLI*****************************ATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEWN****************************************
******H*KCYIWSVVLYGSETWTMRKKEEKYLESFEMW***************NEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPE**********************EDIDE*********************************ADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHAR*********************************************
MDSNNNHAKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVYPPSPEPTRELLANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEWNMWK***********************AMIGDRMEDGLREM
****NNHAKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVYPPSPEPTRE**ANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEW*****************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSNNNHAKCYIWSVVLYGSETWTMRKKEEKYLESFEMWLWRRMEKIKWSDKIRNEEVLRRGFSFLEDFEIVSGISKVCNKTHRYKLAVKCVQSNIIVFKRKNDIRITHAVILEDPYEDLPELVYPPSPEPTRELLANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEWxxxxxxxxxxxxxxxxxxxxxxxxxxxxMIGDRMEDGLREM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query309 2.2.26 [Sep-21-2011]
Q8WUA2 492 Peptidyl-prolyl cis-trans yes N/A 0.805 0.506 0.477 3e-52
Q9CXG3 492 Peptidyl-prolyl cis-trans yes N/A 0.805 0.506 0.477 6e-52
Q4WAQ9459 Peptidyl-prolyl cis-trans yes N/A 0.508 0.342 0.625 1e-50
Q2U256461 Peptidyl-prolyl cis-trans yes N/A 0.508 0.340 0.618 6e-50
Q5ARI5461 Peptidyl-prolyl cis-trans yes N/A 0.508 0.340 0.637 2e-48
P0C1I6446 Peptidyl-prolyl cis-trans N/A N/A 0.511 0.354 0.596 3e-47
Q9UUE4432 Peptidyl-prolyl cis-trans yes N/A 0.508 0.363 0.596 3e-45
Q4IE79 485 Peptidyl-prolyl cis-trans no N/A 0.514 0.327 0.587 3e-43
P0C196 551 Peptidyl-prolyl cis-trans N/A N/A 0.504 0.283 0.553 3e-41
Q871A4 494 Peptidyl-prolyl cis-trans N/A N/A 0.517 0.323 0.576 4e-41
>sp|Q8WUA2|PPIL4_HUMAN Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens GN=PPIL4 PE=1 SV=1 Back     alignment and function desciption
 Score =  206 bits (523), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 126/264 (47%), Positives = 169/264 (64%), Gaps = 15/264 (5%)

Query: 15  VVLYGSETWTMRKKE----EKYLESFEMWLWRRMEKIKWSDK----IRNEEVLRRGFSFL 66
           ++  G  T T R  E    + Y +    +   ++ +IK   K    + N    + G  FL
Sbjct: 50  IIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQFL 109

Query: 67  ----EDFEIVSGISKVCNKTHRYKLAVKCVQSNIIV--FKRKNDIRITHAVILEDPYEDL 120
               E+ + + G+  V  +       +K +    +   F    DIRI H VIL+DP++D 
Sbjct: 110 ITTGENLDYLDGVHTVFGEVTEGMDIIKKINETFVDKDFVPYQDIRINHTVILDDPFDDP 169

Query: 121 PELVYPP-SPEPTRELLANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIVGD 179
           P+L+ P  SPEPTRE L +G IGADE+ID+  G SA+E+EE++AE+EAK +A +LE+VGD
Sbjct: 170 PDLLIPDRSPEPTREQLDSGRIGADEEIDDFKGRSAEEVEEIKAEKEAKTQAILLEMVGD 229

Query: 180 LPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFD 239
           LP+AD  PPENVLFVCKLNPVT+D+DLEIIFSRFG +  CEVIRD  TG+SL YAF+EF+
Sbjct: 230 LPDADIKPPENVLFVCKLNPVTTDEDLEIIFSRFGPIRSCEVIRDWKTGESLCYAFIEFE 289

Query: 240 NPKSCEDAYLKMDNVLIDDRRIHA 263
             + CE A+ KMDNVLIDDRRIH 
Sbjct: 290 KEEDCEKAFFKMDNVLIDDRRIHV 313




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9CXG3|PPIL4_MOUSE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus GN=Ppil4 PE=2 SV=2 Back     alignment and function description
>sp|Q4WAQ9|PPIL4_ASPFU Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp6 PE=3 SV=1 Back     alignment and function description
>sp|Q2U256|PPIL4_ASPOR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cyp6 PE=3 SV=1 Back     alignment and function description
>sp|Q5ARI5|PPIL4_EMENI Peptidyl-prolyl cis-trans isomerase-like 4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp6 PE=3 SV=1 Back     alignment and function description
>sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 Back     alignment and function description
>sp|Q9UUE4|PPIL4_SCHPO Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 Back     alignment and function description
>sp|Q4IE79|PPIL4_GIBZE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=CYP6 PE=3 SV=2 Back     alignment and function description
>sp|P0C196|PPIL4_USTMA Peptidyl-prolyl cis-trans isomerase-like 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP6 PE=3 SV=1 Back     alignment and function description
>sp|Q871A4|PPIL4_NEUCR Peptidyl-prolyl cis-trans isomerase-like 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyp-6 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
156545479 501 PREDICTED: peptidyl-prolyl cis-trans iso 0.517 0.319 0.739 2e-62
21355677 653 CG5808 [Drosophila melanogaster] gi|4972 0.530 0.251 0.715 2e-62
328791237 507 PREDICTED: peptidyl-prolyl cis-trans iso 0.517 0.315 0.726 3e-62
195158659 615 GL13859 [Drosophila persimilis] gi|19411 0.647 0.325 0.615 6e-62
380018663 613 PREDICTED: peptidyl-prolyl cis-trans iso 0.517 0.261 0.720 7e-62
91089021 467 PREDICTED: similar to CG5808 CG5808-PA [ 0.517 0.342 0.732 7e-62
383847372 507 PREDICTED: peptidyl-prolyl cis-trans iso 0.517 0.315 0.720 1e-61
198449749 494 GA26948 [Drosophila pseudoobscura pseudo 0.818 0.512 0.513 1e-61
194745953 621 GF18772 [Drosophila ananassae] gi|190628 0.533 0.265 0.716 1e-61
328794028330 PREDICTED: peptidyl-prolyl cis-trans iso 0.517 0.484 0.726 1e-61
>gi|156545479|ref|XP_001606947.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  245 bits (626), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 119/161 (73%), Positives = 137/161 (85%), Gaps = 1/161 (0%)

Query: 103 NDIRITHAVILEDPYEDLPELVYPP-SPEPTRELLANGLIGADEDIDETAGLSAQEIEEL 161
            DIRI+H VILEDPYED   L  P  SPEPT+E L +  IGADE ID+TAG++A+EI E+
Sbjct: 152 QDIRISHTVILEDPYEDPKGLEVPDRSPEPTKEALMSDRIGADEAIDDTAGMTAEEIAEM 211

Query: 162 RAEREAKARATILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEV 221
           + E+EAKARATILEIVGD+P+A+ APPENVLFVCKLNPVTSDDDLE+IFSRFGK+  CEV
Sbjct: 212 QKEKEAKARATILEIVGDIPDAEMAPPENVLFVCKLNPVTSDDDLEVIFSRFGKIVGCEV 271

Query: 222 IRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIH 262
           IRD+ TGDSLQYAF+EF   KSCE+AY KMDNVLIDDRRIH
Sbjct: 272 IRDRQTGDSLQYAFIEFAERKSCEEAYFKMDNVLIDDRRIH 312




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|21355677|ref|NP_651291.1| CG5808 [Drosophila melanogaster] gi|4972682|gb|AAD34736.1| unknown [Drosophila melanogaster] gi|7301211|gb|AAF56342.1| CG5808 [Drosophila melanogaster] gi|220943598|gb|ACL84342.1| CG5808-PA [synthetic construct] gi|220953568|gb|ACL89327.1| CG5808-PA [synthetic construct] Back     alignment and taxonomy information
>gi|328791237|ref|XP_001121334.2| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Apis mellifera] Back     alignment and taxonomy information
>gi|195158659|ref|XP_002020203.1| GL13859 [Drosophila persimilis] gi|194116972|gb|EDW39015.1| GL13859 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|380018663|ref|XP_003693245.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Apis florea] Back     alignment and taxonomy information
>gi|91089021|ref|XP_968771.1| PREDICTED: similar to CG5808 CG5808-PA [Tribolium castaneum] gi|270011537|gb|EFA07985.1| hypothetical protein TcasGA2_TC005570 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383847372|ref|XP_003699328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|198449749|ref|XP_002136956.1| GA26948 [Drosophila pseudoobscura pseudoobscura] gi|198130740|gb|EDY67514.1| GA26948 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|194745953|ref|XP_001955449.1| GF18772 [Drosophila ananassae] gi|190628486|gb|EDV44010.1| GF18772 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|328794028|ref|XP_003251965.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like, partial [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query309
FB|FBgn0027617 653 CG5808 [Drosophila melanogaste 0.530 0.251 0.642 1.3e-50
UNIPROTKB|F1N6W2 492 PPIL4 "Uncharacterized protein 0.634 0.398 0.517 8.5e-49
UNIPROTKB|Q8WUA2 492 PPIL4 "Peptidyl-prolyl cis-tra 0.634 0.398 0.517 8.5e-49
MGI|MGI:1914668 492 Ppil4 "peptidylprolyl isomeras 0.634 0.398 0.517 1.4e-48
RGD|1311051 492 Ppil4 "peptidylprolyl isomeras 0.634 0.398 0.517 1.4e-48
UNIPROTKB|F1P661 526 PPIL4 "Uncharacterized protein 0.634 0.372 0.512 1.8e-48
UNIPROTKB|E1C3R0 478 PPIL4 "Uncharacterized protein 0.634 0.410 0.512 6e-48
UNIPROTKB|I3LGX0 471 PPIL4 "Uncharacterized protein 0.634 0.416 0.507 2e-47
WB|WBGene00000890427 sig-7 [Caenorhabditis elegans 0.563 0.407 0.547 1.4e-46
ZFIN|ZDB-GENE-030131-6251454 ppil4 "peptidylprolyl isomeras 0.543 0.370 0.563 4.8e-46
FB|FBgn0027617 CG5808 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 526 (190.2 bits), Expect = 1.3e-50, P = 1.3e-50
 Identities = 106/165 (64%), Positives = 120/165 (72%)

Query:    99 FKRKNDIRITHAVILEDPYEDLPELVYPP-SPEPTRELLANGLIGADEDIDETAGLSXXX 157
             F+   DIRITH V+LEDP+ +   L  P  SP P+ E L NG I ADEDID+T G++   
Sbjct:   148 FRPYQDIRITHTVVLEDPFPNPRGLQAPSRSPSPSAERLKNGRIAADEDIDDTDGMTAEE 207

Query:   158 XXXXXXXXXXXXXXTILEIVGDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVN 217
                           TILEIVGDLP+AD APPENVLFVCKLNPVT+DDDLEIIFS FG + 
Sbjct:   208 MQEMLAEREAKARATILEIVGDLPDADMAPPENVLFVCKLNPVTTDDDLEIIFSSFGVLK 267

Query:   218 CCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIH 262
              CEVIRD+ TGDSLQYAFVEF++ KSCE AY KMDNVLIDDRRIH
Sbjct:   268 GCEVIRDRKTGDSLQYAFVEFEDQKSCEAAYFKMDNVLIDDRRIH 312




GO:0003729 "mRNA binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|F1N6W2 PPIL4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WUA2 PPIL4 "Peptidyl-prolyl cis-trans isomerase-like 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1914668 Ppil4 "peptidylprolyl isomerase (cyclophilin)-like 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311051 Ppil4 "peptidylprolyl isomerase (cyclophilin)-like 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P661 PPIL4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3R0 PPIL4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGX0 PPIL4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00000890 sig-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6251 ppil4 "peptidylprolyl isomerase (cyclophilin)-like 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4WAQ9PPIL4_ASPFU5, ., 2, ., 1, ., 80.6250.50800.3420yesN/A
Q9UUE4PPIL4_SCHPO5, ., 2, ., 1, ., 80.59620.50800.3634yesN/A
Q2U256PPIL4_ASPOR5, ., 2, ., 1, ., 80.61870.50800.3405yesN/A
P0CP88PPIL4_CRYNJ5, ., 2, ., 1, ., 80.55620.50160.3075yesN/A
Q5ARI5PPIL4_EMENI5, ., 2, ., 1, ., 80.63750.50800.3405yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 4e-51
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-18
smart0036073 smart00360, RRM, RNA recognition motif 6e-18
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 6e-15
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 3e-14
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 4e-13
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 2e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 9e-12
pfam0007670 pfam00076, RRM_1, RNA recognition motif 1e-11
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 3e-11
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 4e-11
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 7e-11
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 1e-10
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 5e-10
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 6e-10
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 7e-10
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 8e-10
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 1e-09
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 1e-09
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 4e-09
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 6e-09
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 7e-09
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 7e-09
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 7e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 8e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 2e-08
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 2e-08
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-08
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-08
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-08
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-08
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 7e-08
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 8e-08
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 1e-07
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 2e-07
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-07
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 2e-07
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-07
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 2e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 3e-07
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 3e-07
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 4e-07
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 5e-07
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 5e-07
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 7e-07
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 7e-07
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 8e-07
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 8e-07
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 9e-07
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 9e-07
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 1e-06
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 1e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-06
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 1e-06
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-06
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 2e-06
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-06
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 3e-06
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 4e-06
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 4e-06
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 4e-06
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 4e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-06
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 5e-06
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 5e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 5e-06
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 5e-06
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 6e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 6e-06
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 7e-06
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 7e-06
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 8e-06
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 8e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-05
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-05
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-05
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 2e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-05
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 2e-05
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 2e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 2e-05
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-05
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 2e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 3e-05
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 3e-05
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-05
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-05
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 4e-05
cd1226085 cd12260, RRM2_SREK1, RNA recognition motif 2 in sp 4e-05
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 5e-05
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 6e-05
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 6e-05
TIGR01659 346 TIGR01659, sex-lethal, sex-lethal family splicing 1e-04
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 1e-04
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 1e-04
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 1e-04
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 1e-04
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 2e-04
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-04
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 2e-04
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 2e-04
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 2e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 3e-04
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 3e-04
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 4e-04
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 4e-04
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 4e-04
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 4e-04
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 5e-04
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 5e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 5e-04
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 5e-04
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 6e-04
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 6e-04
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 7e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 8e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 8e-04
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 9e-04
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 9e-04
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 9e-04
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 9e-04
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 0.001
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.001
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 0.001
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 0.001
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 0.001
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 0.001
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 0.001
cd12302110 cd12302, RRM_scSet1p_like, RNA recognition motif i 0.001
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 0.001
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 0.001
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 0.001
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 0.002
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 0.002
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 0.002
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.002
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 0.002
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 0.002
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 0.003
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.003
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 0.003
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 0.003
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 0.003
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 0.004
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 0.004
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 0.004
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 0.004
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
 Score =  163 bits (414), Expect = 4e-51
 Identities = 62/76 (81%), Positives = 69/76 (90%)

Query: 187 PPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCED 246
           PPENVLFVCKLNPVT+D+DLEIIFSRFGK+  CEVIRDK TGDSLQYAF+EF+  + CE+
Sbjct: 1   PPENVLFVCKLNPVTTDEDLEIIFSRFGKIKSCEVIRDKKTGDSLQYAFIEFETKEDCEE 60

Query: 247 AYLKMDNVLIDDRRIH 262
           AY KMDNVLIDDRRIH
Sbjct: 61  AYFKMDNVLIDDRRIH 76


This subfamily corresponds to the RRM of PPIase, also termed cyclophilin-like protein PPIL4, or rotamase PPIL4, a novel nuclear RNA-binding protein encoded by cyclophilin-like PPIL4 gene. The precise role of PPIase remains unclear. PPIase contains a conserved N-terminal peptidyl-prolyl cistrans isomerase (PPIase) motif, a central RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain), followed by a lysine rich domain, and a pair of bipartite nuclear targeting sequences (NLS) at the C-terminus. Length = 83

>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240706 cd12260, RRM2_SREK1, RNA recognition motif 2 in splicing regulatory glutamine/lysine-rich protein 1 (SREK1) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240748 cd12302, RRM_scSet1p_like, RNA recognition motif in budding yeast Saccharomyces cerevisiae SET domain-containing protein 1 (scSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 309
KOG0415|consensus 479 100.0
KOG0113|consensus 335 99.78
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.72
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.66
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.61
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.6
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.56
KOG0149|consensus 247 99.56
KOG0122|consensus270 99.53
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.5
KOG0121|consensus153 99.5
KOG0126|consensus219 99.5
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.48
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.48
KOG4207|consensus 256 99.46
KOG0125|consensus 376 99.45
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.45
PLN03120 260 nucleic acid binding protein; Provisional 99.45
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.44
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.44
PLN03213 759 repressor of silencing 3; Provisional 99.43
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.43
smart0036272 RRM_2 RNA recognition motif. 99.41
KOG0107|consensus195 99.41
KOG0148|consensus 321 99.41
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.39
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.38
smart0036071 RRM RNA recognition motif. 99.38
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.38
KOG0117|consensus 506 99.37
PLN03121 243 nucleic acid binding protein; Provisional 99.36
KOG0114|consensus124 99.36
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.35
KOG0127|consensus 678 99.34
KOG0145|consensus 360 99.34
KOG0111|consensus 298 99.33
KOG0130|consensus170 99.32
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.31
KOG0148|consensus321 99.29
KOG0131|consensus203 99.29
KOG0108|consensus 435 99.28
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.26
KOG0146|consensus371 99.25
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.21
KOG0127|consensus 678 99.21
KOG0145|consensus360 99.21
smart0036170 RRM_1 RNA recognition motif. 99.2
KOG0144|consensus 510 99.2
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.18
KOG0147|consensus 549 99.18
KOG0124|consensus 544 99.17
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.16
KOG0131|consensus203 99.16
KOG4208|consensus214 99.12
KOG0117|consensus 506 99.11
KOG0144|consensus 510 99.11
KOG0226|consensus290 99.09
KOG0105|consensus 241 99.09
KOG4206|consensus221 99.08
KOG0109|consensus 346 99.0
KOG0123|consensus 369 98.98
KOG0109|consensus 346 98.93
KOG0123|consensus 369 98.88
KOG0124|consensus 544 98.86
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 98.86
KOG4212|consensus 608 98.85
KOG0110|consensus725 98.84
KOG4205|consensus311 98.77
KOG4661|consensus 940 98.77
KOG0146|consensus 371 98.75
KOG0132|consensus 894 98.74
KOG4205|consensus 311 98.72
KOG0153|consensus377 98.7
KOG0533|consensus243 98.67
KOG0110|consensus725 98.66
KOG1548|consensus 382 98.65
KOG1457|consensus 284 98.59
KOG4209|consensus231 98.57
KOG0151|consensus 877 98.54
KOG4212|consensus608 98.54
KOG0116|consensus419 98.51
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 98.29
KOG4454|consensus 267 98.25
KOG4660|consensus 549 98.21
KOG0106|consensus 216 98.16
KOG0120|consensus500 98.15
KOG1190|consensus492 97.98
KOG0147|consensus 549 97.86
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.85
KOG1995|consensus 351 97.78
KOG4211|consensus 510 97.69
KOG4210|consensus285 97.68
KOG1457|consensus284 97.66
KOG4206|consensus221 97.62
KOG2314|consensus 698 97.58
KOG4211|consensus 510 97.51
KOG3152|consensus278 97.5
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.47
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.44
KOG4849|consensus 498 97.43
KOG1190|consensus492 97.24
KOG0129|consensus520 97.18
KOG0106|consensus216 97.17
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.15
KOG1548|consensus382 96.97
KOG0120|consensus500 96.88
KOG1456|consensus494 96.79
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 96.65
KOG2193|consensus 584 96.62
KOG4307|consensus944 96.59
KOG0128|consensus881 96.55
KOG1855|consensus 484 96.45
KOG1456|consensus 494 96.24
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 96.23
KOG0112|consensus 975 96.16
KOG0105|consensus241 96.15
KOG0129|consensus 520 96.1
KOG1365|consensus 508 96.05
KOG2416|consensus 718 95.89
KOG4307|consensus 944 95.85
KOG2202|consensus260 95.77
KOG1996|consensus378 95.32
KOG0115|consensus 275 95.24
KOG0128|consensus881 95.12
KOG4676|consensus 479 94.92
KOG1365|consensus 508 94.61
KOG0112|consensus 975 94.47
KOG2068|consensus 327 94.13
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.62
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 93.49
KOG2253|consensus 668 92.53
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 92.46
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 91.33
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 91.26
KOG2135|consensus526 91.14
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 90.84
KOG4210|consensus285 90.49
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 89.55
KOG2318|consensus 650 89.15
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 88.52
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 87.57
KOG4660|consensus549 87.51
KOG2591|consensus 684 86.31
KOG4574|consensus 1007 85.44
KOG0804|consensus 493 85.01
KOG2891|consensus 445 84.3
KOG4285|consensus350 83.8
>KOG0415|consensus Back     alignment and domain information
Probab=100.00  E-value=3.1e-39  Score=293.74  Aligned_cols=170  Identities=66%  Similarity=1.060  Sum_probs=166.7

Q ss_pred             ccccCCccccceEeecCCCCCCCCCCCC-CCCCCchhhhhcCCCCCCCCCccccCCCHHHHHHHHHHHHHHHHhhHHhHh
Q psy15676         99 FKRKNDIRITHAVILEDPYEDLPELVYP-PSPEPTRELLANGLIGADEDIDETAGLSAQEIEELRAEREAKARATILEIV  177 (309)
Q Consensus        99 ~rp~~~iri~h~~il~dPf~~p~~l~~p-~~p~p~~~~~~~~~~~~de~~~~~e~~~~~e~~e~~~~~e~~~~~~~~e~~  177 (309)
                      ++||+||||.||+||+|||++||.|..| ++|+|+++++..+++..|++.+++++.+.+++++..++++++++|.+++++
T Consensus       148 ~rPykdIRI~HTiiLdDPFddpp~l~~p~rspsPt~e~l~~g~i~~de~~d~~~g~saeel~e~~~e~ea~~~A~iLEmv  227 (479)
T KOG0415|consen  148 NRPYKDIRIKHTIILDDPFDDPPDLAEPMRSPSPTPEQLVKGRIRLDEDEDDDEGLSAEELEEVLAEKEAKAQAVILEMV  227 (479)
T ss_pred             CCcccceeeeeeEEecCCCCCchhhccCCCCCCCCHHHhhccccccCcccccccccCHHHHHHHHHHHHHHhhHhHHHHh
Confidence            7999999999999999999999999988 999999999999999999999999999999999999999999999999999


Q ss_pred             cCCCCCCCCCCCcEEEecCCCCCCCHHHHHHHHhcCCceeEEEEeeeCCCCCcccEEEEEecCHHHHHHHHHHcCCceeC
Q psy15676        178 GDLPEADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLID  257 (309)
Q Consensus       178 ~~~~~~~~~~~~~~lfV~nL~~~~te~~L~~~F~~fG~I~~v~i~~d~~tg~skG~aFV~F~~~~~a~~Al~~l~g~~i~  257 (309)
                      |++|.++..||.+.|||+.|+|.+|.++|..+|+.||.|.+|.+++|..||.+..||||+|.+.+++++|+..|++..|+
T Consensus       228 GDlpdAd~~PPeNVLFVCKLNPVTtDeDLeiIFSrFG~i~sceVIRD~ktgdsLqyaFiEFen~escE~AyFKMdNvLID  307 (479)
T KOG0415|consen  228 GDLPDADVKPPENVLFVCKLNPVTTDEDLEIIFSRFGKIVSCEVIRDRKTGDSLQYAFIEFENKESCEQAYFKMDNVLID  307 (479)
T ss_pred             cCCcccccCCCcceEEEEecCCcccccchhhHHhhcccceeeeEEecccccchhheeeeeecchhhHHHHHhhhcceeec
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeEEEEeecC
Q psy15676        258 DRRIHARGEEW  268 (309)
Q Consensus       258 gr~I~V~~a~~  268 (309)
                      +++|+|+|+++
T Consensus       308 DrRIHVDFSQS  318 (479)
T KOG0415|consen  308 DRRIHVDFSQS  318 (479)
T ss_pred             cceEEeehhhh
Confidence            99999999986



>KOG0113|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG2891|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 7e-08
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 2e-07
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 3e-07
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 3e-07
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 6e-07
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 9e-07
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 1e-06
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 4e-06
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 4e-06
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 1e-05
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 3e-05
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 3e-05
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 3e-05
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-05
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 3e-05
3pgw_S 437 Crystal Structure Of Human U1 Snrnp Length = 437 3e-05
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 4e-05
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 7e-05
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 7e-05
1sxl_A97 Resonance Assignments And Solution Structure Of The 8e-05
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 1e-04
2khc_A118 Bruno Rrm3+ Length = 118 1e-04
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 1e-04
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 2e-04
1x4e_A85 Solution Structure Of Rrm Domain In Rna Binding Mot 3e-04
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 3e-04
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 4e-04
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 4e-04
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 5e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 6e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 6e-04
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 6e-04
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 7e-04
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 7e-04
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 8e-04
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 7e-08, Method: Compositional matrix adjust. Identities = 24/70 (34%), Positives = 40/70 (57%) Query: 183 ADAAPPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPK 242 A+ A N ++V ++ SDDD++ +F FGK+ C + RD TG Y F+E++ + Sbjct: 104 AEEARAFNRIYVASVHQDLSDDDIKSVFEAFGKIKSCTLARDPTTGKHKGYGFIEYEKAQ 163 Query: 243 SCEDAYLKMD 252 S +DA M+ Sbjct: 164 SSQDAVSSMN 173
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1X4E|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 2 Length = 85 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query309
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 7e-27
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-26
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-20
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-18
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-13
1x4e_A85 RNA binding motif, single-stranded interacting pro 3e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-13
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 4e-17
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-16
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-16
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-16
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-16
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-16
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 3e-16
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 8e-16
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 9e-16
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 1e-12
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 3e-15
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-15
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-10
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-07
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 9e-15
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 9e-15
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-14
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-14
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-14
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 1e-14
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-14
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-13
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-14
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-14
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-14
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-14
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 4e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 4e-14
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-10
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 5e-14
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 7e-14
2cqd_A116 RNA-binding region containing protein 1; RNA recog 8e-14
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 8e-14
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 9e-14
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-10
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 1e-13
2cpj_A99 Non-POU domain-containing octamer-binding protein; 1e-13
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-13
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-13
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 1e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-09
2f3j_A177 RNA and export factor binding protein 2; RRM domai 2e-13
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-13
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-13
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-13
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-13
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-13
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-13
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-13
3n9u_C156 Cleavage and polyadenylation specificity factor S; 4e-13
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 4e-13
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 5e-13
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 5e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-12
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-13
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 8e-13
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 9e-13
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 9e-13
3q2s_C229 Cleavage and polyadenylation specificity factor S; 1e-12
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 1e-12
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 1e-12
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-12
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-12
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 1e-12
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-12
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 2e-12
2div_A99 TRNA selenocysteine associated protein; structural 3e-12
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-12
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-12
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-12
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-12
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-12
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 4e-12
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 4e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 4e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-12
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-08
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 5e-12
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 5e-12
1x5p_A97 Negative elongation factor E; structure genomics, 5e-12
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 6e-12
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-08
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 7e-12
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 9e-12
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 1e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-11
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 9e-11
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-11
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-11
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 2e-11
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 2e-11
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-11
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-11
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-11
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 3e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 4e-11
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-11
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 5e-11
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 6e-11
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 6e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-10
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 6e-11
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-11
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 8e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 8e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 9e-11
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 1e-10
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-09
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 9e-11
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-10
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-10
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-10
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-10
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-10
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-10
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 2e-10
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-10
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 2e-10
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-10
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-10
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 3e-10
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 4e-10
3p5t_L90 Cleavage and polyadenylation specificity factor S; 6e-10
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-10
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-05
2cph_A107 RNA binding motif protein 19; RNA recognition moti 8e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 9e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 8e-08
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-09
2dis_A109 Unnamed protein product; structural genomics, RRM 2e-09
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-09
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-09
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 4e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 5e-09
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 2e-08
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 2e-08
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 3e-08
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 4e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 4e-08
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 4e-08
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 5e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 7e-08
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 9e-08
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-07
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-07
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-07
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 4e-07
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 5e-07
2krb_A81 Eukaryotic translation initiation factor 3 subunit 6e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 7e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 8e-07
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 9e-07
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-06
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 3e-06
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 5e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 5e-06
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 5e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 8e-06
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 1e-05
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 1e-05
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-05
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 4e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 6e-04
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
 Score =  108 bits (270), Expect = 7e-27
 Identities = 39/205 (19%), Positives = 66/205 (32%), Gaps = 11/205 (5%)

Query: 115 DPYEDLPELVYPPSPE----------PTRELLANGLIGADEDIDETAGLSAQEIEELRAE 164
           DP   LP L   P  +          P      +          ET     +     + E
Sbjct: 17  DPIPYLPPLEKLPHEKHHNQPYCGIAPYIREFEDPRDAPPPTRAETREERMERKRREKIE 76

Query: 165 REAKARATILEIVGDLPEADAAP-PENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIR 223
           R  +   T L++     + +A       LFV ++N  T++  L   F  +G +    ++ 
Sbjct: 77  RRQQEVETELKMWDPHNDPNAQGDAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVY 136

Query: 224 DKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEWNMWKRREEEEEKEEI 283
            K +G    YAF+E+++ +    AY   D   ID RR+    E     K          +
Sbjct: 137 SKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVERGRTVKGWRPRRLGGGL 196

Query: 284 DEKKEEEEKEDRAMIGDRMEDGLRE 308
              +      +    G        E
Sbjct: 197 GGTRRGGADVNIRHSGRDDTSRYDE 221


>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.84
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.82
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.8
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.8
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.79
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.79
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.79
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.79
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.78
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.78
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.78
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.78
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.78
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.78
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.77
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.77
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.77
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.77
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.77
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.77
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.77
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.77
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.77
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.77
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.77
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.77
2div_A99 TRNA selenocysteine associated protein; structural 99.76
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.76
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.76
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.76
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.76
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.76
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.76
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.76
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.76
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.76
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.76
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.76
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.76
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.76
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.76
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.75
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.75
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.75
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.75
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.75
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.75
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.75
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.75
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.75
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.74
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.74
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.74
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.74
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.74
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.74
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.74
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.74
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.74
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.74
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.74
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.74
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.74
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.73
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.73
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.73
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.73
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.73
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.73
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.73
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.73
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.73
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.72
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.72
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.72
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.72
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.72
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.72
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.72
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.72
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.71
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.71
2dis_A109 Unnamed protein product; structural genomics, RRM 99.71
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.71
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.71
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.71
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.71
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.71
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.7
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.7
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.7
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.7
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.7
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.69
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.69
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.69
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.69
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.69
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.69
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.69
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.69
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.69
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.69
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.69
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.68
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.68
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.68
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.68
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.68
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.68
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.68
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.68
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.68
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.68
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.68
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.67
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.67
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.67
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.49
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.67
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.67
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.67
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.67
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.67
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.67
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.66
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.66
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.66
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.66
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.66
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.66
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.66
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.66
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.65
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.65
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.65
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.65
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.64
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.64
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.64
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.64
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.64
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.63
1x5p_A97 Negative elongation factor E; structure genomics, 99.63
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.63
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.63
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.62
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.62
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.62
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.62
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.62
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.62
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.61
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.61
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.61
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.61
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.6
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.6
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.6
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.6
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.59
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.59
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.58
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.57
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.57
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.57
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.57
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.57
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.56
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.56
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.55
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.55
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.55
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.55
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.54
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.54
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.54
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.53
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.52
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.52
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.51
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.51
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.5
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.5
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.48
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.47
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.47
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.46
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.46
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.45
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.44
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.43
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.43
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.43
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.42
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.41
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.4
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.4
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.37
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.37
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.28
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.26
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.23
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.17
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.0
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.93
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.84
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.15
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.34
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 96.69
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.68
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 96.57
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.01
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 95.86
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 94.6
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.35
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 94.25
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 93.67
2i2y_A150 Fusion protein consists of immunoglobin G- binding 93.09
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 82.54
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
Probab=99.84  E-value=9.9e-21  Score=147.12  Aligned_cols=83  Identities=29%  Similarity=0.427  Sum_probs=79.4

Q ss_pred             CCCCcEEEecCCCCCCCHHHHHHHHhcCCceeEEEEeeeCCCCCcccEEEEEecCHHHHHHHHHHcCCceeCCeeEEEEe
Q psy15676        186 APPENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARG  265 (309)
Q Consensus       186 ~~~~~~lfV~nL~~~~te~~L~~~F~~fG~I~~v~i~~d~~tg~skG~aFV~F~~~~~a~~Al~~l~g~~i~gr~I~V~~  265 (309)
                      ...+++|||+|||+++|+++|+.+|++||.|.++.+++|+.||.++|||||+|.+.++|.+|+..|||..++|++|.|++
T Consensus        16 ~~~gt~lfV~nLp~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~afV~f~~~~~A~~Ai~~lng~~~~gr~l~V~~   95 (99)
T 4fxv_A           16 YFQGTNLIVNYLPQNMTQDELRSLFSSIGEVESAKLIRDKVAGHSLGYGFVNYVTAKDAERAINTLNGLRLQSKTIKVSY   95 (99)
T ss_dssp             CCCCSEEEEESCCTTCCHHHHHHHHHTTSCEEEEEEEECSSSCCEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEEE
T ss_pred             cCCCCEEEEeCCCCCCCHHHHHHHHHhcCCEEEeEeeecCCCCcccccEEEEECCHHHHHHHHHHhCCCEECCEEEEEEE
Confidence            34568999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecC
Q psy15676        266 EEW  268 (309)
Q Consensus       266 a~~  268 (309)
                      |++
T Consensus        96 AkP   98 (99)
T 4fxv_A           96 ARP   98 (99)
T ss_dssp             CCB
T ss_pred             eeC
Confidence            975



>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 309
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-13
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-12
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 1e-12
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-12
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-12
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 5e-12
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 7e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 3e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 3e-11
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 3e-11
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 7e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-10
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-10
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-10
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 2e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-10
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 3e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-09
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 1e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 3e-09
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 4e-09
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 4e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 4e-09
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 5e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 6e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 7e-09
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 8e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 8e-09
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 9e-09
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 9e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-08
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-08
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 4e-08
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 4e-08
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 5e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 5e-08
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 7e-08
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 7e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 1e-07
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-07
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-07
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 4e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 5e-07
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-05
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-07
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 8e-07
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-06
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-06
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 3e-06
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 4e-06
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 5e-06
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 5e-06
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 5e-06
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 6e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 7e-06
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 1e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 3e-05
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-05
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 8e-05
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 1e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-04
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 0.001
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 0.002
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.003
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.003
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 0.004
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 0.004
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 62.6 bits (152), Expect = 2e-13
 Identities = 23/71 (32%), Positives = 34/71 (47%)

Query: 192 LFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKM 251
           L+V  L+P  ++  L   FS  G +    V RD +T  SL YA+V F  P   E A   M
Sbjct: 3   LYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDTM 62

Query: 252 DNVLIDDRRIH 262
           +  +I  + + 
Sbjct: 63  NFDVIKGKPVR 73


>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query309
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.84
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.83
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.83
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.83
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.83
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.83
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.83
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.82
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.82
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.82
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.8
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.8
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.8
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.8
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.8
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.8
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.79
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.79
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.79
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.79
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.79
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.79
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.79
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.79
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.79
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.78
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.78
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.78
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.78
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.77
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.77
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.77
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.77
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.77
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.76
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.76
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.76
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.75
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.73
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.73
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.72
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.72
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.72
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.72
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.71
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.71
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.71
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.71
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.71
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.7
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.7
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.7
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.7
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.69
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.68
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.68
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.68
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.68
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.68
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.67
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.67
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.67
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.66
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.65
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.65
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.65
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.65
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.64
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.63
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.63
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.62
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.59
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.59
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.59
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.57
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.56
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.54
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.53
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.47
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.46
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.4
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.4
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.33
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.32
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.31
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.4
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 96.92
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 96.68
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 93.08
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Sex-lethal protein
species: Drosophila melanogaster [TaxId: 7227]
Probab=99.84  E-value=5.2e-21  Score=141.64  Aligned_cols=80  Identities=26%  Similarity=0.454  Sum_probs=77.6

Q ss_pred             CcEEEecCCCCCCCHHHHHHHHhcCCceeEEEEeeeCCCCCcccEEEEEecCHHHHHHHHHHcCCceeCCeeEEEEeecC
Q psy15676        189 ENVLFVCKLNPVTSDDDLEIIFSRFGKVNCCEVIRDKVTGDSLQYAFVEFDNPKSCEDAYLKMDNVLIDDRRIHARGEEW  268 (309)
Q Consensus       189 ~~~lfV~nL~~~~te~~L~~~F~~fG~I~~v~i~~d~~tg~skG~aFV~F~~~~~a~~Al~~l~g~~i~gr~I~V~~a~~  268 (309)
                      +++|||+|||+++|+++|..+|++||.|.++.+++++.+|.++|||||+|.+.++|++|+..|||..++|+.|+|++|++
T Consensus         2 ~t~l~V~nLp~~~t~~~l~~~F~~~G~v~~~~i~~~~~~g~~~g~afV~f~~~~~A~~ai~~lng~~~~g~~l~v~~a~p   81 (82)
T d1b7fa1           2 NTNLIVNYLPQDMTDRELYALFRAIGPINTCRIMRDYKTGYSYGYAFVDFTSEMDSQRAIKVLNGITVRNKRLKVSYARP   81 (82)
T ss_dssp             CSEEEEECCCTTCCHHHHHHHHHTTSCEEEEECCEETTTTEECSEEEEEESSHHHHHHHHHHHTTCEETTEECEEEECCC
T ss_pred             CCEEEEeCCCCCCCHHHHHHHHHHhCCcceeeeeeecccCCccccceEEECCHHHHHHHHHHhCCCEECCEEEEEEEcCC
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999975



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure