Diaphorina citri psyllid: psy15677


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI
cccEEEcccccccccccccccccccccccccccccccccccccccCEEEECccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHHcc
ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase-like 4 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.confidentQ8WUA2
Peptidyl-prolyl cis-trans isomerase-like 4 PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.confidentQ9CXG3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005740 [CC]mitochondrial envelopeprobableGO:0031967, GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0031975, GO:0044446, GO:0044444, GO:0044429, GO:0005575, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0071011 [CC]precatalytic spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000413 [BP]protein peptidyl-prolyl isomerizationprobableGO:0044267, GO:0018208, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0016018 [MF]cyclosporin A bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005488, GO:0008144
GO:0003755 [MF]peptidyl-prolyl cis-trans isomerase activityprobableGO:0003824, GO:0003674, GO:0016853, GO:0016859
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0005576 [CC]extracellular regionprobableGO:0005575
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZKC, chain A
Confidence level:very confident
Coverage over the Query: 1-95
View the alignment between query and template
View the model in PyMOL