Psyllid ID: psy15677


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90------
ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI
cccEEEcccccccccccccccccccccccccccccccccccccccEEEEEEccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHHcc
ccEEEEccccccccccccEEcccccccccHHHHHHHccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHccc
anfiaqtgdptgvgtggssvfglaygdharyyeaetqpkiphskpglvsmvhcgegllgsqffitlgpdlkslnehcvfgeIAEGFDILLKLNNAI
anfiaqtgdptgvgtggSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI
ANFIAQTGDPtgvgtggssvFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI
****************GSSVFGLAYGDHARYYEAET***I***KPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKL****
ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNA*
ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI
*NFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query96 2.2.26 [Sep-21-2011]
Q8WUA2 492 Peptidyl-prolyl cis-trans yes N/A 0.958 0.186 0.559 1e-23
Q9CXG3 492 Peptidyl-prolyl cis-trans yes N/A 0.958 0.186 0.559 2e-23
P0C1I6 446 Peptidyl-prolyl cis-trans N/A N/A 0.958 0.206 0.495 1e-19
Q9UUE4 432 Peptidyl-prolyl cis-trans yes N/A 0.979 0.217 0.442 4e-14
Q8X191162 Peptidyl-prolyl cis-trans yes N/A 0.875 0.518 0.395 1e-13
Q4WCR3161 Peptidyl-prolyl cis-trans yes N/A 0.875 0.521 0.395 3e-13
Q5ASQ0162 Peptidyl-prolyl cis-trans yes N/A 0.875 0.518 0.395 5e-13
Q5NVL7646 Peptidylprolyl isomerase no N/A 0.885 0.131 0.391 8e-13
Q8CEC6646 Peptidylprolyl isomerase no N/A 0.885 0.131 0.391 8e-13
Q96BP3646 Peptidylprolyl isomerase no N/A 0.885 0.131 0.391 8e-13
>sp|Q8WUA2|PPIL4_HUMAN Peptidyl-prolyl cis-trans isomerase-like 4 OS=Homo sapiens GN=PPIL4 PE=1 SV=1 Back     alignment and function desciption
 Score =  108 bits (269), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 52/93 (55%), Positives = 63/93 (67%), Gaps = 1/93 (1%)

Query: 2   NFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQ 61
           +FI QTGDPTG G GG S+FG  YGD A ++EAE  P+I H K G VSMV+ G    GSQ
Sbjct: 48  DFIIQTGDPTGTGRGGESIFGQLYGDQASFFEAEKVPRIKHKKKGTVSMVNNGSDQHGSQ 107

Query: 62  FFITLGPDLKSLNE-HCVFGEIAEGFDILLKLN 93
           F IT G +L  L+  H VFGE+ EG DI+ K+N
Sbjct: 108 FLITTGENLDYLDGVHTVFGEVTEGMDIIKKIN 140




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9CXG3|PPIL4_MOUSE Peptidyl-prolyl cis-trans isomerase-like 4 OS=Mus musculus GN=Ppil4 PE=2 SV=2 Back     alignment and function description
>sp|P0C1I6|PPIL4_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 4 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp13 PE=3 SV=1 Back     alignment and function description
>sp|Q9UUE4|PPIL4_SCHPO Peptidyl-prolyl cis-trans isomerase cyp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cyp6 PE=1 SV=1 Back     alignment and function description
>sp|Q8X191|PPIL1_ASPNG Peptidyl-prolyl cis-trans isomerase-like 1 OS=Aspergillus niger GN=cypC PE=3 SV=1 Back     alignment and function description
>sp|Q4WCR3|PPIL1_ASPFU Peptidyl-prolyl cis-trans isomerase-like 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|Q5ASQ0|PPIL1_EMENI Peptidyl-prolyl cis-trans isomerase-like 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cyp1 PE=3 SV=1 Back     alignment and function description
>sp|Q5NVL7|PPWD1_PONAB Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Pongo abelii GN=PPWD1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CEC6|PPWD1_MOUSE Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Mus musculus GN=Ppwd1 PE=2 SV=2 Back     alignment and function description
>sp|Q96BP3|PPWD1_HUMAN Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens GN=PPWD1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
307166099 490 Peptidyl-prolyl cis-trans isomerase-like 0.989 0.193 0.697 3e-34
307196041 451 Peptidyl-prolyl cis-trans isomerase-like 1.0 0.212 0.680 5e-34
156545479 501 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.191 0.670 3e-33
193579992 472 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.203 0.680 4e-33
322797592 508 hypothetical protein SINV_07432 [Solenop 0.989 0.187 0.677 5e-33
383847372 507 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.189 0.649 1e-32
380018663 613 PREDICTED: peptidyl-prolyl cis-trans iso 0.989 0.154 0.656 1e-32
332026097 504 Peptidyl-prolyl cis-trans isomerase-like 0.989 0.188 0.666 2e-32
328791237 507 PREDICTED: peptidyl-prolyl cis-trans iso 0.989 0.187 0.656 2e-32
350407880 502 PREDICTED: peptidyl-prolyl cis-trans iso 1.0 0.191 0.639 6e-32
>gi|307166099|gb|EFN60351.1| Peptidyl-prolyl cis-trans isomerase-like 4 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  148 bits (374), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 67/96 (69%), Positives = 79/96 (82%), Gaps = 1/96 (1%)

Query: 2   NFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQ 61
           NFIAQTGDPTG G GG SV+G+  G+ ARYYEAE  PKI H++ GL+SMV+CG  +LGSQ
Sbjct: 48  NFIAQTGDPTGTGKGGESVYGIVLGEKARYYEAEHMPKIKHNRIGLLSMVNCGNNMLGSQ 107

Query: 62  FFITLGPDLKSL-NEHCVFGEIAEGFDILLKLNNAI 96
           FFITLGP+L+SL NEHCVFGEI EG +I+LK N AI
Sbjct: 108 FFITLGPELQSLDNEHCVFGEITEGLEIILKFNEAI 143




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307196041|gb|EFN77766.1| Peptidyl-prolyl cis-trans isomerase-like 4 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156545479|ref|XP_001606947.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|193579992|ref|XP_001945585.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like isoform 3 [Acyrthosiphon pisum] gi|328708407|ref|XP_003243680.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|322797592|gb|EFZ19633.1| hypothetical protein SINV_07432 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383847372|ref|XP_003699328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380018663|ref|XP_003693245.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Apis florea] Back     alignment and taxonomy information
>gi|332026097|gb|EGI66245.1| Peptidyl-prolyl cis-trans isomerase-like 4 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328791237|ref|XP_001121334.2| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Apis mellifera] Back     alignment and taxonomy information
>gi|350407880|ref|XP_003488226.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 4-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query96
FB|FBgn0027617 653 CG5808 [Drosophila melanogaste 0.979 0.143 0.505 6e-20
WB|WBGene00000890 427 sig-7 [Caenorhabditis elegans 0.989 0.222 0.437 3.9e-18
UNIPROTKB|I3LGX0 471 PPIL4 "Uncharacterized protein 0.958 0.195 0.494 2.4e-17
UNIPROTKB|F1N6W2 492 PPIL4 "Uncharacterized protein 0.958 0.186 0.494 2.7e-17
UNIPROTKB|Q8WUA2 492 PPIL4 "Peptidyl-prolyl cis-tra 0.958 0.186 0.494 2.7e-17
UNIPROTKB|F1P661 526 PPIL4 "Uncharacterized protein 0.958 0.174 0.494 3.1e-17
MGI|MGI:1914668 492 Ppil4 "peptidylprolyl isomeras 0.958 0.186 0.494 3.4e-17
RGD|1311051 492 Ppil4 "peptidylprolyl isomeras 0.958 0.186 0.494 3.4e-17
UNIPROTKB|E1C3R0 478 PPIL4 "Uncharacterized protein 0.958 0.192 0.494 5.3e-17
ZFIN|ZDB-GENE-030131-6251 454 ppil4 "peptidylprolyl isomeras 0.958 0.202 0.473 9.8e-17
FB|FBgn0027617 CG5808 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 6.0e-20, P = 6.0e-20
 Identities = 48/95 (50%), Positives = 64/95 (67%)

Query:     3 FIAQTGDPXXXXXXXXXXFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQF 62
             FIAQTGDP          +G+  G   R++EAE  PKI HS  G++S+V  G+ L+GSQF
Sbjct:    49 FIAQTGDPSGAGDGGSSIWGVVEGPQKRFFEAEFLPKINHSSAGMLSLVSAGKNLVGSQF 108

Query:    63 FITLGPDLKSLN-EHCVFGEIAEGFDILLKLNNAI 96
             F+TLG +L SL+  HCV GE+ EG ++L KLN+AI
Sbjct:   109 FLTLGENLTSLDGNHCVIGEVVEGHEVLRKLNDAI 143




GO:0003729 "mRNA binding" evidence=ISS
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0006457 "protein folding" evidence=IEA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
WB|WBGene00000890 sig-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGX0 PPIL4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N6W2 PPIL4 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WUA2 PPIL4 "Peptidyl-prolyl cis-trans isomerase-like 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P661 PPIL4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1914668 Ppil4 "peptidylprolyl isomerase (cyclophilin)-like 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311051 Ppil4 "peptidylprolyl isomerase (cyclophilin)-like 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C3R0 PPIL4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6251 ppil4 "peptidylprolyl isomerase (cyclophilin)-like 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8WUA2PPIL4_HUMAN5, ., 2, ., 1, ., 80.55910.95830.1869yesN/A
Q9CXG3PPIL4_MOUSE5, ., 2, ., 1, ., 80.55910.95830.1869yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 4e-37
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 1e-20
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 1e-19
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 7e-19
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 4e-18
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 4e-18
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 1e-17
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 1e-17
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 3e-16
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 3e-15
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 9e-14
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 1e-07
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 2e-04
PRK05972 860 PRK05972, ligD, ATP-dependent DNA ligase; Reviewed 0.001
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
 Score =  122 bits (308), Expect = 4e-37
 Identities = 54/96 (56%), Positives = 71/96 (73%), Gaps = 1/96 (1%)

Query: 2   NFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQ 61
           +FIAQTGDPTG G GG S++   YG  AR++E E  P + HSK G VSMV+ G+ L GSQ
Sbjct: 45  DFIAQTGDPTGTGAGGESIYSQLYGRQARFFEPEILPLLKHSKKGTVSMVNAGDNLNGSQ 104

Query: 62  FFITLGPDLKSLN-EHCVFGEIAEGFDILLKLNNAI 96
           F+ITLG +L  L+ +H VFG++ EGFD+L K+N+AI
Sbjct: 105 FYITLGENLDYLDGKHTVFGQVVEGFDVLEKINDAI 140


This subfamily of the cyclophilin domain family contains a number of eukaryotic cyclophilins having the RRM domain including the nuclear proteins: human hCyP-57, Arabidopsis thaliana AtCYP59, Caenorhabditis elegans CeCyP-44 and Paramecium tetrurelia Kin241. The Kin241 protein has been shown to have a role in cell morphogenesis. Length = 166

>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|235658 PRK05972, ligD, ATP-dependent DNA ligase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 96
KOG0880|consensus217 100.0
KOG0546|consensus 372 100.0
KOG0881|consensus164 100.0
KOG0882|consensus558 100.0
KOG0883|consensus 518 100.0
KOG0884|consensus161 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
KOG0879|consensus177 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
KOG0111|consensus298 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 99.98
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 99.98
KOG0415|consensus 479 99.97
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 99.97
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 99.97
PTZ00060183 cyclophilin; Provisional 99.96
PTZ00221249 cyclophilin; Provisional 99.96
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 99.96
KOG0865|consensus167 99.96
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 99.95
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 99.94
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 99.94
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 99.94
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 99.93
KOG0885|consensus 439 99.93
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 99.89
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 94.65
PRK00969 508 hypothetical protein; Provisional 94.28
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 88.26
KOG0882|consensus 558 82.7
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 80.7
PRK00969 508 hypothetical protein; Provisional 80.39
>KOG0880|consensus Back     alignment and domain information
Probab=100.00  E-value=1.5e-38  Score=217.41  Aligned_cols=86  Identities=44%  Similarity=0.759  Sum_probs=82.0

Q ss_pred             CCeEEEeCCCC-CCCCCCCccccCccCCCCCcCCCCcCCCCCCCCCceEEEeecCCCCccceEEEEeCCCCCCCC-CceE
Q psy15677          1 ANFIAQTGDPT-GVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLN-EHCV   78 (96)
Q Consensus         1 ~~f~iQgGD~~-~~g~gg~~~~~~~~~~~~~~~~~e~~~~l~h~~~G~lsma~~~~~~~~sqFfI~~~~~~~~ld-~~~v   78 (96)
                      |||||||||++ ++|+|+.|+||       ..|+|||+ .|+|++||.|||||.|||+||||||||+.. .+||| +|+|
T Consensus        95 ~nfmIQGGd~t~g~gtGg~SIyG-------~~F~DENf-~LkH~rpG~lSMAn~GpDtNGsQFfItT~~-t~wLDGkhVV  165 (217)
T KOG0880|consen   95 PNFMIQGGDFTKGDGTGGKSIYG-------EKFPDENF-KLKHDRPGRLSMANAGPDTNGSQFFITTVK-TPWLDGKHVV  165 (217)
T ss_pred             cCceeecCccccCCCCCCeEeec-------CCCCCccc-eeecCCCceEeeeccCCCCCCceEEEEecC-CccccCceeE
Confidence            79999999999 88999999999       67999996 999999999999999999999999999986 89999 9999


Q ss_pred             EEEEEcCHHHHHHHHhh
Q psy15677         79 FGEIAEGFDILLKLNNA   95 (96)
Q Consensus        79 FG~Vi~G~dvl~~I~~~   95 (96)
                      ||+|++|||+|.+|+.+
T Consensus       166 FGqVl~Gmdvv~~Ie~~  182 (217)
T KOG0880|consen  166 FGQVLEGMDVVRKIENV  182 (217)
T ss_pred             EeeehhhHHHHHHHHhc
Confidence            99999999999999864



>KOG0546|consensus Back     alignment and domain information
>KOG0881|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 3e-09
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 4e-09
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 7e-09
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 1e-08
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 3e-08
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 2e-07
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 3e-06
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 3e-06
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 3e-06
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 3e-06
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 3e-06
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 3e-06
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 3e-06
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 4e-06
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 4e-06
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 4e-06
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 4e-06
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 4e-06
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 9e-06
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 1e-05
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 1e-05
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 1e-05
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 1e-05
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 1e-05
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 1e-05
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 3e-05
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 3e-05
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 5e-05
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 6e-05
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 6e-05
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 7e-05
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 8e-05
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 1e-04
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 2e-04
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 2e-04
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 2e-04
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 2e-04
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 2e-04
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 2e-04
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 2e-04
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 2e-04
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 2e-04
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 2e-04
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 2e-04
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 3e-04
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 3e-04
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 3e-04
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 3e-04
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 3e-04
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 3e-04
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 3e-04
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 3e-04
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 3e-04
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 4e-04
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 5e-04
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 5e-04
1dyw_A173 Biochemical And Structural Characterization Of A Di 5e-04
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 6e-04
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 7e-04
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 9e-04
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure

Iteration: 1

Score = 56.6 bits (135), Expect = 3e-09, Method: Compositional matrix adjust. Identities = 27/59 (45%), Positives = 37/59 (62%) Query: 34 AETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLNEHCVFGEIAEGFDILLKL 92 A+ ++ H+KPGL+SM + G GSQFFIT P +H VFGE+ EG DI+ K+ Sbjct: 83 ADENFQVKHTKPGLLSMANAGANTNGSQFFITTVPTSWLDGKHVVFGEVIEGLDIVRKV 141
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query96
2hq6_A185 Serologically defined colon cancer antigen 10; pro 1e-28
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 1e-27
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 1e-27
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 2e-26
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 2e-26
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 2e-26
2b71_A196 Cyclophilin-like protein; structural genomics, str 4e-25
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 1e-24
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 2e-24
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 3e-24
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 5e-24
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 2e-17
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 2e-16
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 4e-16
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 6e-16
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 7e-16
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 8e-16
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 9e-15
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 3e-14
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 4e-14
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 7e-14
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 9e-14
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 9e-14
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-13
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-13
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-13
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 1e-13
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 2e-13
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 2e-12
1z81_A229 Cyclophilin; structural genomics, structural genom 4e-12
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 1e-11
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 2e-11
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 3e-06
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 3e-06
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 2e-05
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
 Score =  100 bits (251), Expect = 1e-28
 Identities = 34/96 (35%), Positives = 53/96 (55%), Gaps = 10/96 (10%)

Query: 2   NFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQ 61
            FI Q GDPTG G+GG S++G         ++ E   ++  ++ GLV+M + G    GSQ
Sbjct: 72  GFIVQGGDPTGTGSGGESIYG-------APFKDEFHSRLRFNRRGLVAMANAGSHDNGSQ 124

Query: 62  FFITLGPDLKSLN-EHCVFGEIA-EGFDILLKLNNA 95
           FF TLG     LN +H +FG++  +    +L+L+  
Sbjct: 125 FFFTLGR-ADELNNKHTIFGKVTGDTVYNMLRLSEV 159


>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 99.98
2hq6_A185 Serologically defined colon cancer antigen 10; pro 99.97
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 99.97
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 99.97
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 99.97
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 99.96
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 99.95
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
Probab=100.00  E-value=1.5e-36  Score=202.97  Aligned_cols=87  Identities=46%  Similarity=0.809  Sum_probs=82.2

Q ss_pred             CCeEEEeCCCCCCCCCCCccccCccCCCCCcCCCCcCCCCCCCCCceEEEeecCCCCccceEEEEeCCCCCCCC-CceEE
Q psy15677          1 ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLN-EHCVF   79 (96)
Q Consensus         1 ~~f~iQgGD~~~~g~gg~~~~~~~~~~~~~~~~~e~~~~l~h~~~G~lsma~~~~~~~~sqFfI~~~~~~~~ld-~~~vF   79 (96)
                      |+|||||||++++|+|+.++|+       +.|++|+.+.++|+++|+||||+++|++++|||||++.+ .|+|| +|+||
T Consensus        52 ~~f~iQgGd~~~~g~gg~si~g-------~~~~dE~~~~l~h~~~G~lsmA~~gp~s~~SQFfI~~~~-~~~Ldg~~tvF  123 (160)
T 2fu0_A           52 KHFMVQTGDPSGDGTGGESIWG-------NEFEDEFFDHLNHSKPFMVSMANCGPNTNGSQFFITTVP-CPWLDFKHTVF  123 (160)
T ss_dssp             TTTEEEECCTTSSSSCCCCTTS-------SCBCCCCBTTBCSSSSSEEEECCSSTTCBCSCEEEESSC-CGGGTTTSCEE
T ss_pred             CCCEEEeCCcCCCCCCCCcccC-------CCccccccCCcccCCceEEEEecCCCCCcccEEEEECCC-CCccCCCcEEE
Confidence            7899999999999999999998       578999877899999999999999999999999999996 89999 99999


Q ss_pred             EEEEcCHHHHHHHHhh
Q psy15677         80 GEIAEGFDILLKLNNA   95 (96)
Q Consensus        80 G~Vi~G~dvl~~I~~~   95 (96)
                      |||++|||||++|+++
T Consensus       124 G~Vv~G~dvv~~I~~~  139 (160)
T 2fu0_A          124 GKVTQGSKIVLDIEKV  139 (160)
T ss_dssp             EEEEECHHHHHHHHTS
T ss_pred             EEEEcCHHHHHHHHhC
Confidence            9999999999999875



>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 96
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 3e-15
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 2e-12
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 3e-11
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 1e-10
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 9e-10
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 1e-09
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 4e-09
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 7e-09
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 8e-09
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 9e-09
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-08
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 1e-08
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 1e-08
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 4e-08
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 1e-07
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 8e-07
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 3e-06
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 1e-05
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 9e-05
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-04
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 64.4 bits (156), Expect = 3e-15
 Identities = 30/94 (31%), Positives = 52/94 (55%), Gaps = 7/94 (7%)

Query: 2   NFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQ 61
           +F+ Q GDPTG G GG+S++G       + +E E  P +  +  G+++M + G    GSQ
Sbjct: 59  DFMIQGGDPTGTGRGGASIYG-------KQFEDELHPDLKFTGAGILAMANAGPDTNGSQ 111

Query: 62  FFITLGPDLKSLNEHCVFGEIAEGFDILLKLNNA 95
           FF+TL P      +H +FG + +G  ++ ++   
Sbjct: 112 FFVTLAPTQWLDGKHTIFGRVCQGIGMVNRVGMV 145


>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query96
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 99.96
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 99.96
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 99.96
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 99.96
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 99.95
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 99.95
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 99.95
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 99.95
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 99.95
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 99.95
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 99.94
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 99.94
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 99.94
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 99.94
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 99.94
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 99.94
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 99.94
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 99.93
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 99.93
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 99.93
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.91
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.91
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like protein PPIL3B
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96  E-value=9.2e-30  Score=167.60  Aligned_cols=87  Identities=41%  Similarity=0.741  Sum_probs=78.0

Q ss_pred             CCeEEEeCCCCCCCCCCCccccCccCCCCCcCCCCcCCCCCCCCCceEEEeecCCCCccceEEEEeCCCCCCCC-CceEE
Q psy15677          1 ANFIAQTGDPTGVGTGGSSVFGLAYGDHARYYEAETQPKIPHSKPGLVSMVHCGEGLLGSQFFITLGPDLKSLN-EHCVF   79 (96)
Q Consensus         1 ~~f~iQgGD~~~~g~gg~~~~~~~~~~~~~~~~~e~~~~l~h~~~G~lsma~~~~~~~~sqFfI~~~~~~~~ld-~~~vF   79 (96)
                      |+|+||+||+...+.++...|+       ..++.|..+.++|.++|+||||++++++++|||||++.+ .|+|| +|+||
T Consensus        47 ~~~~iq~Gd~~~~~~~~~~~~~-------~~~~~e~~~~~~~~~~G~lsma~~~~~s~~sqFfIt~~~-~p~ld~~~tvF  118 (159)
T d2ok3a1          47 KGFMVQTGDPTGTGRGGNSIWG-------KKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGK-QPHLDMKYTVF  118 (159)
T ss_dssp             TTTEEEECCTTSSSSCCCCTTS-------SCBCCCCCTTCCSCSTTEEEECCSSTTCBCSCEEEESSC-CGGGTTTSCEE
T ss_pred             CCeEEEeCCccccCCCCcccCC-------CccccccccCCCCCCCeEEEEeeCCCCCcCcceEeeecc-CcccccceEEE
Confidence            6899999999877777777676       457777777899999999999999999999999999996 79999 99999


Q ss_pred             EEEEcCHHHHHHHHhh
Q psy15677         80 GEIAEGFDILLKLNNA   95 (96)
Q Consensus        80 G~Vi~G~dvl~~I~~~   95 (96)
                      |||++||+||++|+++
T Consensus       119 G~V~~G~~vl~~I~~~  134 (159)
T d2ok3a1         119 GKVIDGLETLDELEKL  134 (159)
T ss_dssp             EEEEECHHHHHHHHTC
T ss_pred             EecccchHHHHHHHcC
Confidence            9999999999999875



>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure