Diaphorina citri psyllid: psy15684


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MNSLLNGKDSRWLQLEVCREFQRNKCSRPDTECKFAHPPANVEVQNGRVTACYDSVHVPTPSASLLILLPMWRCRMEE
ccccccccccccEEHHHHHHHHcccccccccccccccccccEEECccEEEEEEccccccccccccccccccccccccc
**********RWLQLEVCREFQRNKCSRPDTECKFAHPPANVEVQNGRVTACYDSVHVPTPSASLLILLPMWRC****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSLLNGKDSRWLQLEVCREFQRNKCSRPDTECKFAHPPANVEVQNGRVTACYDSVHVPTPSASLLILLPMWRCRMEE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Muscleblind-like protein 1 Involved in pre-mRNA alternative splicing regulation. Binds to CUG triplet repeat in RNA.confidentQ5ZKW9
Protein muscleblind Required for terminal differentiation of photoreceptor cells. Vital for embryonic development.confidentO16011

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043484 [BP]regulation of RNA splicingprobableGO:0080090, GO:0019222, GO:0060255, GO:0051252, GO:0031323, GO:0050794, GO:0050789, GO:0019219, GO:0065007, GO:0051171, GO:0008150, GO:0010468
GO:0045662 [BP]negative regulation of myoblast differentiationprobableGO:0048634, GO:0051147, GO:0051148, GO:0048641, GO:0050789, GO:0060284, GO:0065007, GO:0045661, GO:1901861, GO:0016202, GO:0050793, GO:0048742, GO:0050794, GO:0051153, GO:0045595, GO:0008150, GO:0051239, GO:0048519, GO:0051093, GO:0045596, GO:2000026, GO:0048523
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0010494 [CC]cytoplasmic stress granuleprobableGO:0005737, GO:0035770, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0032991, GO:0005622, GO:0043226
GO:0003725 [MF]double-stranded RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045445 [BP]myoblast differentiationprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0061061, GO:0008150, GO:0009987, GO:0042692, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2RPP, chain A
Confidence level:very confident
Coverage over the Query: 3-71
View the alignment between query and template
View the model in PyMOL