Diaphorina citri psyllid: psy15691

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620

MNDDYDDEQTHRWDQDMVDVDSDGGDDPMENPQEVLNECLEKFSTPDYIMEPGIFSQLKRYFQAGGNPEQVIELLSQNYKAVAQMANLVAEWLILGGVNVTEVQAMVENHLKDMILKTFDPKKADTIFTEEGETPAWLTEMIEHPTWRSLIYRLAEEYPDCLMLNFTIKLISDAGFQREITSISTAAQQIEVFSRVLKTSISNFLESSDDWQSSVEECAKMVCHGQHTYVYSQVLLQVLSLESKGGSKVKRLAQEITKCAQQSGHDVTPIIMALNGAAFYPQANQALSSMISRNSLNPADITVLFRLYSSPDPPPIDLIRIPQFLELLTDSLFKPGVKLNPEHKPKYIYLLAYASSVYEVSTGKKTKQKSFNKDDLKTTIQAIEKVHSICNSSKSSNELIAEITTLFHCIRYPVVSVGVIRWVECTVTEPSYFKLCTEHTPTHLALLDEVVTCHTFLHHKVLQLFIELFESKQDELEILVQLEMRKMLLDRMVNLLCRGCVVPVVKYVKQCWQRGDTDISLIRYFVTEVLEAITPPYTPEFVQLFLPIVENDEITGTMRGDGENDPVSEFIVQTLEHEWHQLEDDKKIYQCWPVHFSSVDFVIEPKGTYGRRITEILTMQ

ccccccHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccHHHHHHHHcccccccccHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHccccccccccEEECccccccccHHHHHccc

************************************NECLEKFSTPDYIMEPGIFSQLKRYFQAGGNPEQVIELLSQNYKAVAQMANLVAEWLILGGVNVTEVQAMVENHLKDMILKTFDPKKADTIFTEEGETPAWLTEMIEHPTWRSLIYRLAEEYPDCLMLNFTIKLISDAGFQREITSISTAAQQIEVFSRVLKTSISNFLESSDDWQSSVEECAKMVCHGQHTYVYSQVLLQVLSLESKGGSKVKRLAQEITKCAQQSGHDVTPIIMALNGAAFYPQANQALSSMISRNSLNPADITVLFRLYSSPDPPPIDLIRIPQFLELLTDSLFKPGVKLNPEHKPKYIYLLAYASSVYEVST***********DDLKTTIQAIEKVHSICNS***SNELIAEITTLFHCIRYPVVSVGVIRWVECTVTEPSYFKLCTEHTPTHLALLDEVVTCHTFLHHKVLQLFIELFESKQDELEILVQLEMRKMLLDRMVNLLCRGCVVPVVKYVKQCWQRGDTDISLIRYFVTEVLEAITPPYTPEFVQLFLPIVENDEITGTMR*****DPVSEFIVQTLEHEWHQLEDDKKIYQCWPVHFSSVDFVIEPKGTYGRRITEILTMQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Negative elongation factor D	Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex, causes transcriptional pausing.	very confident	Q24134
Negative elongation factor C/D	Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex.	very confident	Q8IXH7
Negative elongation factor D	Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex.	very confident	Q922L6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007070 [BP]	negative regulation of transcription from RNA polymerase II promoter during mitosis	confident	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0046021, GO:0010629, GO:0007068, GO:0050789, GO:0010605, GO:0019222, GO:0000122, GO:2000112, GO:2000113, GO:0060255, GO:0010556, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045896, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0006357, GO:0008150, GO:0010558, GO:0048523
GO:0034244 [BP]	negative regulation of transcription elongation from RNA polymerase II promoter	confident	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0034243, GO:0045934, GO:0019219, GO:0032784, GO:0009889, GO:0032785, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0003729 [MF]	mRNA binding	confident	GO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0017053 [CC]	transcriptional repressor complex	confident	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032021 [CC]	NELF complex	confident	GO:0008023, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0022008 [BP]	neurogenesis	confident	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0006368 [BP]	transcription elongation from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0006366, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006354, GO:0006351, GO:0019438
GO:0050434 [BP]	positive regulation of viral transcription	probable	GO:0009893, GO:0019222, GO:0031328, GO:2000243, GO:0031325, GO:2000241, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:0019219, GO:0065007, GO:0046782, GO:0031326, GO:0048518, GO:0045935, GO:0060255, GO:0050792, GO:0009889, GO:0050794, GO:0043902, GO:0043900, GO:0008150, GO:0051171, GO:2001141, GO:0051173, GO:0051252, GO:0051254, GO:0010557, GO:0010556, GO:0048524, GO:0048522
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0016032 [BP]	viral reproduction	probable	GO:0009987, GO:0044764, GO:0008150, GO:0051704

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!