Diaphorina citri psyllid: psy15695


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MDDVNLRIHLLCKPMYQTGEFHPPVTYTVIFQPQSTQSSSMYESIYEPINPRPPSDLSSRSNYSLYSSNIPPPEAEVDALTDLLVHSLDTSSESDLFAIEKVHSICNSSKSSNELIAEITTLFHCIRYPVVSVGVIRWVECTVTEPSYFKLCTEHTPTHLALLDEVVTCHTFLHHKVLQLFIELFESKQDELEILVQLEMRKMLLDRMVNLLCRGCVVPVVKYVKQCWQRGDTDISLIRYFVTEVLEAITPPYTPEFVQLFLPIVENDEITGTMRGDGENDPVSEFIVHCKAHFVSQNN
cccccccHHccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccEEEHHHHHHHHHccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccc
****NLRIHLLCKPMYQTGEFHPPVTYTVIFQPQSTQSSSMYESIYE***********SRSNYS***************LTDLLVHSL**SSESDLFAIEKVHSICNSSKSSNELIAEITTLFHCIRYPVVSVGVIRWVECTVTEPSYFKLCTEHTPTHLALLDEVVTCHTFLHHKVLQLFIELFESKQDELEILVQLEMRKMLLDRMVNLLCRGCVVPVVKYVKQCWQRGDTDISLIRYFVTEVLEAITPPYTPEFVQLFLPIVENDEITGTMR******PVSEFIVHCKAHFV****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDDVNLRIHLLCKPMYQTGEFHPPVTYTVIFQPQSTQSSSMYESIYEPINPRPPSDLSSRSNYSLYSSNIPPPEAEVDALTDLLVHSLDTSSESDLFAIEKVHSICNSSKSSNELIAEITTLFHCIRYPVVSVGVIRWVECTVTEPSYFKLCTEHTPTHLALLDEVVTCHTFLHHKVLQLFIELFESKQDELEILVQLEMRKMLLDRMVNLLCRGCVVPVVKYVKQCWQRGDTDISLIRYFVTEVLEAITPPYTPEFVQLFLPIVENDEITGTMRGDGENDPVSEFIVHCKAHFVSQNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Negative elongation factor C/D Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex.confidentQ8IXH7
Negative elongation factor D Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex.confidentQ922L6
Negative elongation factor D Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex, causes transcriptional pausing.confidentQ24134

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007070 [BP]negative regulation of transcription from RNA polymerase II promoter during mitosisprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0046021, GO:0010629, GO:0007068, GO:0050789, GO:0010605, GO:0019222, GO:0000122, GO:2000112, GO:2000113, GO:0060255, GO:0010556, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045896, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0006357, GO:0008150, GO:0010558, GO:0048523
GO:0034244 [BP]negative regulation of transcription elongation from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0034243, GO:0045934, GO:0019219, GO:0032784, GO:0009889, GO:0032785, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0003729 [MF]mRNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0017053 [CC]transcriptional repressor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032021 [CC]NELF complexprobableGO:0008023, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0022008 [BP]neurogenesisprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!